Comparing 3607620 FitnessBrowser__Dino:3607620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
35% identity, 92% coverage: 17:226/228 of query aligns to 1:203/205 of 1nsjA
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
33% identity, 92% coverage: 17:226/228 of query aligns to 1:192/194 of 1lbmA
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
35% identity, 87% coverage: 21:219/228 of query aligns to 258:443/452 of 1piiA
Sites not aligning to the query:
7etyA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum in complex with reduced 1-(o-carboxyphenylamino)-1- deoxyribulose 5-phosphate (rcdrp) (see paper)
30% identity, 89% coverage: 21:223/228 of query aligns to 259:462/470 of 7etyA
Sites not aligning to the query:
7etxA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum (see paper)
30% identity, 89% coverage: 21:223/228 of query aligns to 261:464/472 of 7etxA
Sites not aligning to the query:
>3607620 FitnessBrowser__Dino:3607620
MPVLVDPAPRGAARTGVVQVKICGLRTAADVDAAARAGARYGGFVFFPKSPRHLEIDAAA
ALAAEAPVGLAKVALVVNPSDADLDALLARMPVDILQLHGRETPARVTEIRTRTGLPVMK
AVGIAEATDLPAIAAYEAVADQILVDAKPPREATLPGGNGLAFNWRLLQGRVWRKPWMLA
GGLTPETVGEAIRLTGAAQVDVSSGVESAPGVKDAGAIADFVAAAQQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory