Comparing 3607634 FitnessBrowser__Dino:3607634 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
4mncA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21 (see paper)
29% identity, 92% coverage: 23:328/331 of query aligns to 1:299/305 of 4mncA
4n91A Crystal structure of a trap periplasmic solute binding protein from anaerococcus prevotii dsm 20548 (apre_1383), target efi-510023, with bound alpha/beta d-glucuronate (see paper)
30% identity, 37% coverage: 146:269/331 of query aligns to 127:256/308 of 4n91A
Sites not aligning to the query:
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
25% identity, 67% coverage: 56:276/331 of query aligns to 36:268/337 of 2hzlB
Sites not aligning to the query:
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
25% identity, 67% coverage: 56:276/331 of query aligns to 64:296/365 of Q3J1R2
4n8gA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0660), target efi-501075, with bound d-alanine-d-alanine (see paper)
24% identity, 42% coverage: 120:259/331 of query aligns to 105:242/325 of 4n8gA
4p56B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchiseptica, target efi-510038 (bb2442), with bound (r)-mandelate and (s)-mandelate (see paper)
27% identity, 76% coverage: 74:325/331 of query aligns to 51:311/317 of 4p56B
4p56A Crystal structure of a trap periplasmic solute binding protein from bordetella bronchiseptica, target efi-510038 (bb2442), with bound (r)-mandelate and (s)-mandelate (see paper)
27% identity, 76% coverage: 74:325/331 of query aligns to 50:310/315 of 4p56A
>3607634 FitnessBrowser__Dino:3607634
MTLHTRLLAAGAALLLAAPALSQEARLSVVYSLPATNDLMQSYFAFVEDVNANGAGILQI
DLRGGTEILPRNEQMNAVSRGIIDLYFGPAGYYQRQVPELTPLDAAAVPADKLRAAGLHD
AIDAGTRERAGVAFLGAMGTGYNFQFYTITEPKIDDDGTMDFSGLKIRGGASYDPMYQAL
GIARVDVPAGDIYTALERGLVEGIGFTTIGVSSGGWQDFLRYRIFPTWRQGNTIIAANAA
KFDGLTEEQRAYLMEMIQKHEMLAYDAAKALEAVDTAALAEAGVQDVVLEGAGAAEVTAA
FQDTFWVNVAETLGEDAAAKYRAIIDAANGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory