Comparing 3607636 FitnessBrowser__Dino:3607636 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
5ugrA Malyl-coa lyase from methylobacterium extorquens (see paper)
35% identity, 99% coverage: 3:279/281 of query aligns to 9:321/323 of 5ugrA
4l9yC Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
35% identity, 94% coverage: 5:269/281 of query aligns to 11:306/316 of 4l9yC
Q3J5L6 L-malyl-CoA/beta-methylmalyl-CoA lyase; (3S)-malyl-CoA/beta-methylmalyl-CoA lyase; (S)-citramalyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
35% identity, 94% coverage: 5:269/281 of query aligns to 12:307/318 of Q3J5L6
4l9yA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
35% identity, 94% coverage: 5:269/281 of query aligns to 11:306/314 of 4l9yA
4l9zA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa (see paper)
35% identity, 94% coverage: 5:269/281 of query aligns to 10:305/313 of 4l9zA
Q8N0X4 Citramalyl-CoA lyase, mitochondrial; (3S)-malyl-CoA thioesterase; Beta-methylmalate synthase; Citrate lyase subunit beta-like protein; Citrate lyase beta-like; Malate synthase; EC 4.1.3.25; EC 3.1.2.30; EC 2.3.3.-; EC 2.3.3.9 from Homo sapiens (Human) (see 5 papers)
29% identity, 98% coverage: 4:277/281 of query aligns to 44:336/340 of Q8N0X4
Sites not aligning to the query:
5vxcA Crystal structure analysis of human clybl in complex with free coash (see paper)
29% identity, 98% coverage: 4:277/281 of query aligns to 5:297/301 of 5vxcA
5vxoA Crystal structure analysis of human clybl in complex with propionyl- coa (see paper)
29% identity, 98% coverage: 4:277/281 of query aligns to 5:297/298 of 5vxoA
Q9RUZ0 Citrate lyase subunit beta-like protein; EC 4.1.-.- from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
34% identity, 82% coverage: 1:230/281 of query aligns to 1:235/284 of Q9RUZ0
1sgjB Crystal structure of citrate lyase beta subunit
33% identity, 80% coverage: 4:228/281 of query aligns to 2:230/231 of 1sgjB
1sgjA Crystal structure of citrate lyase beta subunit
33% identity, 80% coverage: 4:228/281 of query aligns to 2:230/231 of 1sgjA
6aq4C Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
35% identity, 94% coverage: 10:272/281 of query aligns to 10:264/267 of 6aq4C
6as5A Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, acetoacetate and coenzyme a (see paper)
35% identity, 94% coverage: 10:272/281 of query aligns to 8:262/267 of 6as5A
6aq4B Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
35% identity, 94% coverage: 10:272/281 of query aligns to 10:264/268 of 6aq4B
6arbA Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and coenzyme a (see paper)
35% identity, 94% coverage: 10:272/281 of query aligns to 9:263/268 of 6arbA
S5N020 Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; (3S)-citramalyl-CoA pyruvate-lyase; (S)-citramalyl-CoA lyase; Erythro-beta-methylmalyl-CoA; L-malyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Chloroflexus aurantiacus (see paper)
27% identity, 89% coverage: 30:280/281 of query aligns to 53:337/348 of S5N020
4l80C Crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa (see paper)
27% identity, 89% coverage: 30:280/281 of query aligns to 52:336/347 of 4l80C
Sites not aligning to the query:
1u5vA Structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis
37% identity, 70% coverage: 32:228/281 of query aligns to 31:221/223 of 1u5vA
3r4iA Crystal structure of a citrate lyase (bxe_b2899) from burkholderia xenovorans lb400 at 2.24 a resolution
27% identity, 77% coverage: 64:280/281 of query aligns to 77:311/321 of 3r4iA
>3607636 FitnessBrowser__Dino:3607636
MTAPRALRSFLFAPANRPAIFDKARGSGADAVCLDLEDAVPPDQKATARAPALEWLVQAA
DPGCGVRINGLRTPEGLADIAALCAARPGPGFVLLPKVGAAAEVQIAAEALEAAGSDLSL
GALIETAEGLEAVARIARASDRLSFLLFGAVDLAADLGVDGSDAALAYARGRVVHAGRAA
GRPVLDVPALDFRDLAAVGQAAARAKAHGFSGKAAIHPSNIAVINDAFTPGAEEIAEAQE
VLALYEASPNGLAVRNGKLIEKPVIRAMEARLALARAAGRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory