SitesBLAST
Comparing 3607664 FitnessBrowser__Dino:3607664 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
55% identity, 48% coverage: 126:249/259 of query aligns to 2:125/125 of 1y80A
- active site: D15 (= D139), H17 (= H141), T68 (= T192)
- binding co-5-methoxybenzimidazolylcobamide: D15 (= D139), L16 (≠ I140), H17 (= H141), D18 (= D142), I19 (= I143), G20 (= G144), V24 (= V148), G60 (= G184), M61 (= M185), S62 (= S186), L64 (= L188), L65 (= L189), T66 (= T190), I91 (≠ L215), G93 (= G217), G94 (= G218), A95 (= A219), P112 (≠ R236), D113 (= D237), A114 (= A238)
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
37% identity, 80% coverage: 39:246/259 of query aligns to 2:211/215 of 7xcnP
- binding 5-hydroxybenzimidazolylcobamide: D104 (= D139), I105 (= I140), H106 (= H141), I108 (= I143), G109 (= G144), V113 (= V148), S150 (≠ M185), S151 (= S186), L153 (= L188), M154 (≠ L189), T155 (= T190), M180 (≠ L215), G182 (= G217), G183 (= G218), G200 (≠ C235), S202 (≠ D237), A203 (= A238)
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
33% identity, 79% coverage: 46:249/259 of query aligns to 9:205/206 of 4jgiB
- active site: D95 (= D139), H97 (= H141), A148 (≠ T192)
- binding co-methylcobalamin: L63 (≠ V102), D95 (= D139), L96 (≠ I140), H97 (= H141), D98 (= D142), I99 (= I143), G100 (= G144), F104 (≠ V148), G140 (= G184), S142 (= S186), L145 (= L189), G173 (= G217), G174 (= G218), V175 (≠ A219), S191 (≠ C235), T192 (≠ R236), N193 (≠ D237), A194 (= A238)
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
34% identity, 81% coverage: 41:249/259 of query aligns to 37:242/258 of 2i2xB
- active site: D134 (= D139), H136 (= H141), T187 (= T192)
- binding 5-hydroxybenzimidazolylcob(iii)amide: G133 (= G138), D134 (= D139), V135 (≠ I140), H136 (= H141), D137 (= D142), I138 (= I143), G139 (= G144), V143 (= V148), T179 (≠ G184), T181 (≠ S186), L183 (= L188), M184 (≠ L189), T185 (= T190), A208 (≠ I213), G210 (= G217), G211 (= G218), G212 (≠ A219), G228 (≠ C235), E229 (≠ R236), E230 (≠ D237), A231 (= A238)
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
34% identity, 81% coverage: 41:249/259 of query aligns to 37:242/258 of Q46EH4
- H129 (≠ G134) mutation to K: Does not affect cobalamin-binding.
- H136 (= H141) mutation H->G,K: Abolishes cobalamin-binding.
Sites not aligning to the query:
- 256:258 HKH→KKK: Does not affect cobalamin-binding.
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
34% identity, 81% coverage: 10:219/259 of query aligns to 623:835/1227 of P13009
- E694 (≠ T78) binding
- GDVHD 756:760 (≠ GDIHD 138:142) binding
- D757 (= D139) mutation to E: Decreases activity by about 70%.; mutation to N: Decreases activity by about 45%.
- H759 (= H141) binding axial binding residue; mutation to G: Loss of catalytic activity.
- S804 (= S186) binding
- T808 (= T190) binding
- S810 (≠ T192) mutation to A: Decreases activity by about 40%.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 247 binding
- 310 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 311 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 860 binding
- 946 binding
- 1134 binding
- 1189:1190 binding
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
34% identity, 71% coverage: 36:219/259 of query aligns to 2:185/576 of 3ivaA
- active site: D107 (= D139), H109 (= H141), S160 (≠ T192)
- binding cobalamin: H109 (= H141), G112 (= G144), V116 (= V148), G152 (= G184), L153 (≠ M185), S154 (= S186), L156 (= L188), I157 (≠ L189), T158 (= T190), G183 (= G217), G184 (= G218)
Sites not aligning to the query:
- binding cobalamin: 208, 209, 303, 443, 486, 488, 489, 495, 520, 521, 524, 527, 528
- binding s-adenosyl-l-homocysteine: 447, 484, 485, 489, 491, 539
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
34% identity, 71% coverage: 36:219/259 of query aligns to 2:185/577 of 3bulA
- active site: D107 (= D139), H109 (= H141), S160 (≠ T192)
- binding cobalamin: H109 (= H141), V116 (= V148), G152 (= G184), L153 (≠ M185), S154 (= S186), L156 (= L188), I157 (≠ L189), T158 (= T190), G183 (= G217), G184 (= G218)
Sites not aligning to the query:
- binding cobalamin: 208, 209, 210, 213, 302, 443, 486, 487, 488, 489, 495, 498, 521, 524, 527, 528
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
35% identity, 73% coverage: 36:223/259 of query aligns to 2:189/246 of 1bmtA
- active site: D107 (= D139), H109 (= H141), S160 (≠ T192)
- binding co-methylcobalamin: E44 (≠ T78), M48 (≠ V82), M51 (= M85), G55 (= G89), L65 (≠ V99), V68 (= V102), D107 (= D139), V108 (≠ I140), H109 (= H141), D110 (= D142), I111 (= I143), I115 (≠ L147), G152 (= G184), L153 (≠ M185), S154 (= S186), L156 (= L188), I157 (≠ L189), T158 (= T190), G183 (= G217), G184 (= G218), A185 (= A219)
Sites not aligning to the query:
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8
36% identity, 71% coverage: 43:225/259 of query aligns to 2:179/507 of 8sseA
Sites not aligning to the query:
- binding cobalamin: 405, 409, 451, 452, 453, 454, 463, 485, 488, 490, 492
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
33% identity, 71% coverage: 48:230/259 of query aligns to 2:193/212 of 3ezxA
- active site: D100 (= D139), H102 (= H141), S155 (≠ T192)
- binding 5-hydroxybenzimidazolylcobamide: M47 (= M85), F54 (= F92), D100 (= D139), I101 (= I140), H102 (= H141), D103 (= D142), I104 (= I143), V109 (= V148), V147 (vs. gap), S149 (= S186), L151 (= L188), M152 (≠ L189), T153 (= T190), M178 (≠ L215), G180 (= G217), G181 (= G218)
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
37% identity, 57% coverage: 73:219/259 of query aligns to 704:861/1265 of Q99707
Sites not aligning to the query:
- 61 natural variant: R -> K
- 255 C → Y: in dbSNP:rs1140598
- 382:384 binding
- 449 binding
- 470 binding
- 537 binding
- 579 binding
- 585 binding
- 591 binding
- 919 D → G: in dbSNP:rs1805087
- 963 D→E: Decreases binding to MTRR; when associated with N-1071.
- 1071 K→N: Decreases binding to MTRR; when associated with E-963.
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
35% identity, 66% coverage: 55:225/259 of query aligns to 631:805/841 of 8g3hA
- binding cobalamin: F675 (= F92), V685 (= V102), K693 (= K110), G720 (= G138), V722 (≠ I140), H723 (= H141), D724 (= D142), I725 (= I143), G726 (= G144), V730 (= V148), M767 (= M185), S768 (= S186), L770 (= L188), V772 (≠ T190), I795 (≠ L215), L796 (≠ V216), G797 (= G217), G798 (= G218), A799 (= A219)
Sites not aligning to the query:
Q59268 2-methyleneglutarate mutase; Alpha-methyleneglutarate mutase; EC 5.4.99.4 from Eubacterium barkeri (Clostridium barkeri) (see paper)
38% identity, 38% coverage: 121:218/259 of query aligns to 465:562/614 of Q59268
- D483 (= D139) mutation to N: Activity reduced 2000-fold.
- H485 (= H141) mutation to Q: Loss of activity.
Sites not aligning to the query:
- 464 H→Q: No effect on activity.
5c8dE Crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) (see paper)
30% identity, 51% coverage: 62:193/259 of query aligns to 95:226/280 of 5c8dE
- binding cobalamin: L118 (≠ V82), R122 (≠ T86), G125 (= G89), E138 (≠ V102), S142 (≠ A106), G171 (= G138), R173 (≠ I140), H174 (= H141), E175 (≠ D142), G177 (= G144), S219 (= S186), L222 (= L189)
Sites not aligning to the query:
5c8eA Crystal structure of thermus thermophilus carh bound to adenosylcobalamin and a 26-bp DNA segment (see paper)
30% identity, 51% coverage: 62:193/259 of query aligns to 94:225/273 of 5c8eA
- binding cobalamin: L117 (≠ V82), L120 (≠ M85), G124 (= G89), E137 (≠ V102), G170 (= G138), R172 (≠ I140), H173 (= H141), E174 (≠ D142), G176 (= G144), S218 (= S186), L221 (= L189)
Sites not aligning to the query:
- binding cobalamin: 243, 244, 260, 263
- binding : 20, 25, 26, 33, 36, 37, 38, 38, 39, 62
E3PY95 D-ornithine 4,5-aminomutase subunit beta; D-ornithine aminomutase E component; OAM-E; EC 5.4.3.5 from Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF) (Clostridium sticklandii) (see 2 papers)
30% identity, 49% coverage: 130:256/259 of query aligns to 604:736/740 of E3PY95
- EHS 614:616 (≠ IHD 140:142) binding
- H615 (= H141) binding axial binding residue; mutation to G: Loss of corrinoid-binding ability.
- K626 (≠ M152) modified: N6-(pyridoxal phosphate)lysine
- STIISH 664:669 (≠ SALLT- 186:190) binding
Sites not aligning to the query:
3koyA Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (aerobic) (see paper)
30% identity, 49% coverage: 130:256/259 of query aligns to 595:727/728 of 3koyA
- active site: K617 (≠ M152)
- binding cobalamin: E605 (≠ I140), H606 (= H141), S607 (≠ D142), V608 (≠ I143), V613 (= V148), S655 (= S186), I658 (≠ L189), S659 (≠ T190), G689 (= G217), G690 (= G218), T691 (≠ A219), F707 (≠ C235), G710 (≠ A238), S711 (≠ A239)
Sites not aligning to the query:
- active site: 183, 218, 290
- binding cobalamin: 112, 483
- binding (E)-N~5~-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-ornithine: 77, 105, 109, 110, 156, 158, 178, 183, 188, 218, 219, 290, 292
3koxA Crystal structure of ornithine 4,5 aminomutase in complex with 2,4- diaminobutyrate (anaerobic) (see paper)
30% identity, 49% coverage: 130:256/259 of query aligns to 595:727/728 of 3koxA
- active site: K617 (≠ M152)
- binding cobalamin: E605 (≠ I140), H606 (= H141), S607 (≠ D142), V608 (≠ I143), G609 (= G144), A654 (≠ M185), S655 (= S186), I657 (≠ L188), S659 (≠ T190), G689 (= G217), G690 (= G218), T691 (≠ A219), F707 (≠ C235), G708 (≠ R236), G710 (≠ A238), S711 (≠ A239)
Sites not aligning to the query:
- active site: 183, 218, 290
- binding cobalamin: 112, 483
- binding (2S)-2-amino-4-{[(1Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}butanoic acid: 77, 105, 108, 110, 156, 158, 183, 188, 218, 219, 290
3kowB Crystal structure of ornithine 4,5 aminomutase backsoaked complex (see paper)
30% identity, 49% coverage: 130:256/259 of query aligns to 595:727/728 of 3kowB
- active site: K617 (≠ M152)
- binding cobalamin: E605 (≠ I140), H606 (= H141), S607 (≠ D142), V608 (≠ I143), G609 (= G144), L610 (≠ K145), I657 (≠ L188), G689 (= G217), G690 (= G218), T691 (≠ A219), F707 (≠ C235), S711 (≠ A239)
Sites not aligning to the query:
- active site: 183, 218, 290
- binding pyridoxal-5'-phosphate: 105, 110, 156, 158, 178, 183, 188, 218, 219
Query Sequence
>3607664 FitnessBrowser__Dino:3607664
MSQSAQPAARNDDTLNRNFRPVEDIMADEEDDIILSELSDDELVLQMHDDLYDGLKDEIA
EGVEILLERGWAPYRVLTEALVAGMTIVGNDFRDGILFVPEVLLAANAMKGGMAILKPLL
VETGAPRMGKMVIGTVKGDIHDIGKNLVAMMMEGAGFEVVDLGINNPVENYLEAAQREQA
DIVGMSALLTTTMPYMKVVIDTMVEKGIRDDYIVLVGGAPLNEEFGKAIGADAYCRDAAV
AVETAKDFILRKHNQLAAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory