SitesBLAST
Comparing 3607669 FitnessBrowser__Dino:3607669 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
37% identity, 76% coverage: 1:263/345 of query aligns to 1:263/339 of 1rjwA
- active site: C38 (= C38), H39 (≠ R39), T40 (≠ S40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C89), C95 (= C92), C98 (= C95), C106 (= C103), K110 (≠ R107), C148 (= C146), T152 (= T150)
- binding trifluoroethanol: T40 (≠ S40), C148 (= C146)
- binding zinc ion: C38 (= C38), H61 (= H60), C92 (= C89), C95 (= C92), C98 (= C95), C106 (= C103)
Sites not aligning to the query:
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
37% identity, 76% coverage: 1:263/345 of query aligns to 1:263/337 of 3piiA
- active site: C38 (= C38), H39 (≠ R39), T40 (≠ S40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C89), C95 (= C92), C98 (= C95), C106 (= C103), K110 (≠ R107), C148 (= C146), T152 (= T150)
- binding butyramide: T40 (≠ S40), H61 (= H60), W87 (≠ F85), C148 (= C146)
- binding zinc ion: C38 (= C38), H61 (= H60), E62 (= E61), C92 (= C89), C95 (= C92), C98 (= C95), C106 (= C103), C148 (= C146)
Sites not aligning to the query:
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
37% identity, 77% coverage: 1:264/345 of query aligns to 1:264/336 of 6iqdA
- active site: C38 (= C38), T40 (≠ S40), H43 (= H43), H61 (= H60), C148 (= C146)
- binding zinc ion: C38 (= C38), H61 (= H60), E62 (= E61), C92 (= C89), C95 (= C92), C98 (= C95), C106 (= C103), C148 (= C146)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
37% identity, 76% coverage: 1:263/345 of query aligns to 1:263/337 of P12311
- C38 (= C38) mutation to S: No activity.
- T40 (≠ S40) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (= H43) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
5k1sA Crystal structure of aibc (see paper)
36% identity, 89% coverage: 1:307/345 of query aligns to 15:323/358 of 5k1sA
- active site: C54 (= C38), Y55 (≠ R39), H56 (≠ S40), I59 (≠ H43), E77 (= E61), C106 (= C89), C109 (= C92), C112 (= C95), C120 (= C103), N124 (≠ Q106), C163 (= C146), T167 (= T150)
- binding zinc ion: C54 (= C38), H76 (= H60), C109 (= C92), C112 (= C95), C120 (= C103), C163 (= C146)
Sites not aligning to the query:
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
32% identity, 89% coverage: 9:316/345 of query aligns to 13:319/346 of 2dfvA
- active site: C40 (= C38), G41 (≠ R39), T42 (≠ S40), H45 (vs. gap), H65 (= H60), E66 (= E61), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (≠ R107), P151 (≠ G143), A155 (≠ R147)
- binding nicotinamide-adenine-dinucleotide: G175 (= G173), P176 (≠ G174), L177 (≠ I175), E197 (≠ D194), P198 (≠ V195), R202 (≠ K199), F241 (≠ A237), S242 (≠ L238), A244 (≠ I240), L264 (≠ V260), G265 (= G261), L266 (= L262), I289 (≠ T287), T290 (≠ R288)
- binding zinc ion: C95 (= C89), C101 (= C95), C109 (= C103)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
32% identity, 89% coverage: 9:316/345 of query aligns to 15:321/348 of O58389
- C42 (= C38) binding
- T44 (≠ S40) mutation to A: Total loss of enzymatic activity.
- H67 (= H60) binding
- E68 (= E61) binding
- C97 (= C89) binding
- C100 (= C92) binding
- C103 (= C95) binding
- C111 (= C103) binding
- E152 (≠ A142) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I175) binding
- E199 (≠ D194) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (≠ K199) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGL 260:262) binding
- IT 291:292 (≠ TR 287:288) binding
- R294 (≠ M290) mutation to A: 4000-fold decrease in catalytic efficiency.
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
36% identity, 77% coverage: 1:265/345 of query aligns to 8:271/344 of 6n7lC
- active site: C45 (= C38), T47 (≠ S40), H50 (= H43), H68 (= H60), C154 (= C146)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), H46 (≠ R39), T47 (≠ S40), H50 (= H43), C154 (= C146), T158 (= T150), G178 (= G171), G180 (= G173), G181 (= G174), L182 (≠ I175), D201 (= D194), V202 (= V195), K206 (= K199), T243 (≠ E236), A244 (= A237), V245 (≠ L238), S246 (≠ G239), A249 (≠ T243), N266 (≠ V260), G267 (= G261), L268 (= L262)
- binding zinc ion: C45 (= C38), H68 (= H60), C98 (= C89), C101 (= C92), C104 (= C95), C112 (= C103), C154 (= C146)
Sites not aligning to the query:
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
36% identity, 77% coverage: 1:265/345 of query aligns to 4:265/336 of 6z42A
- active site: C41 (= C38), T43 (≠ S40), H46 (= H43), H64 (= H60), C148 (= C146)
- binding zinc ion: C41 (= C38), H64 (= H60), E65 (= E61), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), C148 (= C146)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
35% identity, 77% coverage: 1:265/345 of query aligns to 1:265/338 of Q8GIX7
- C38 (= C38) binding
- H61 (= H60) binding
- E62 (= E61) binding
- C92 (= C89) binding
- C95 (= C92) binding
- C98 (= C95) binding
- C106 (= C103) binding
- C148 (= C146) binding
3s2fE Crystal structure of furx nadh:furfural
36% identity, 77% coverage: 1:265/345 of query aligns to 3:267/340 of 3s2fE
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C89), C97 (= C92), C100 (= C95), C108 (= C103), Q112 (≠ R107), C150 (= C146), T154 (= T150)
- binding furfural: T42 (≠ S40), W51 (≠ H49), H63 (= H60), W89 (≠ F85), C150 (= C146)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (≠ R39), T42 (≠ S40), C150 (= C146), T154 (= T150), G174 (= G171), G176 (= G173), G177 (= G174), L178 (≠ I175), D197 (= D194), I198 (≠ V195), K202 (= K199), T239 (≠ E236), A240 (= A237), V241 (≠ L238), N262 (≠ V260), G263 (= G261), L264 (= L262)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C89), C97 (= C92), C100 (= C95), C108 (= C103), C150 (= C146)
Sites not aligning to the query:
3s2fA Crystal structure of furx nadh:furfural
36% identity, 77% coverage: 1:265/345 of query aligns to 3:267/340 of 3s2fA
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C89), C97 (= C92), C100 (= C95), C108 (= C103), Q112 (≠ R107), C150 (= C146), T154 (= T150)
- binding phosphorylisopropane: T42 (≠ S40), H63 (= H60), W89 (≠ F85)
- binding zinc ion: C40 (= C38), H63 (= H60), E64 (= E61), C94 (= C89), C97 (= C92), C100 (= C95), C108 (= C103), C150 (= C146)
Sites not aligning to the query:
3s2eE Crystal structure of furx nadh complex 1
36% identity, 77% coverage: 1:265/345 of query aligns to 3:267/340 of 3s2eE
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C89), C97 (= C92), C100 (= C95), C108 (= C103), Q112 (≠ R107), C150 (= C146), T154 (= T150)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (≠ R39), T42 (≠ S40), C150 (= C146), T154 (= T150), G176 (= G173), G177 (= G174), L178 (≠ I175), D197 (= D194), I198 (≠ V195), K202 (= K199), T239 (≠ E236), A240 (= A237), V241 (≠ L238), S242 (≠ G239), A245 (≠ T243), N262 (≠ V260), G263 (= G261), L264 (= L262)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C89), C97 (= C92), C100 (= C95), C108 (= C103), C150 (= C146)
Sites not aligning to the query:
3s2eA Crystal structure of furx nadh complex 1
36% identity, 77% coverage: 1:265/345 of query aligns to 3:267/340 of 3s2eA
- active site: C40 (= C38), H41 (≠ R39), T42 (≠ S40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C89), C97 (= C92), C100 (= C95), C108 (= C103), Q112 (≠ R107), C150 (= C146), T154 (= T150)
- binding zinc ion: C40 (= C38), H63 (= H60), E64 (= E61), C94 (= C89), C97 (= C92), C100 (= C95), C108 (= C103), C150 (= C146)
Sites not aligning to the query:
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
35% identity, 77% coverage: 1:265/345 of query aligns to 1:265/345 of 4z6kA
- active site: C38 (= C38), H39 (≠ R39), T40 (≠ S40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C89), C95 (= C92), C98 (= C95), C106 (= C103), Q110 (≠ R107), C148 (= C146), T152 (= T150)
- binding zinc ion: C38 (= C38), H61 (= H60), C92 (= C89), C95 (= C92), C98 (= C95), C106 (= C103), C148 (= C146)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
35% identity, 88% coverage: 18:320/345 of query aligns to 22:321/342 of 4ejmA
- active site: C40 (= C38), G41 (≠ R39), T42 (≠ S40), H45 (= H43), H61 (= H60), E62 (= E61), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), R109 (= R107), P147 (≠ V148), C151 (≠ W152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G171), G172 (= G173), V173 (≠ G174), I174 (= I175), T194 (≠ V195), R195 (≠ V196), Q196 (≠ D197), K199 (= K199), C240 (≠ A237), E245 (= E242), T246 (= T243), L263 (≠ V260), V265 (vs. gap), I291 (≠ G289)
- binding zinc ion: C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103)
Sites not aligning to the query:
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
35% identity, 88% coverage: 18:320/345 of query aligns to 22:321/343 of 4ej6A
- active site: C40 (= C38), G41 (≠ R39), T42 (≠ S40), H45 (= H43), H61 (= H60), E62 (= E61), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), R109 (= R107), P147 (≠ V148), C151 (≠ W152)
- binding zinc ion: C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103)
Sites not aligning to the query:
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
36% identity, 76% coverage: 1:262/345 of query aligns to 1:268/346 of 4cpdA
- active site: C38 (= C38), G39 (≠ R39), S40 (= S40), H43 (= H43), H59 (= H60), E60 (= E61), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), G107 (≠ R107), D152 (≠ C146), T156 (= T150)
- binding nicotinamide-adenine-dinucleotide: G39 (≠ R39), S40 (= S40), T156 (= T150), G178 (= G173), P179 (≠ G174), V180 (≠ I175), D200 (= D194), R201 (≠ V195), R205 (≠ K199), A243 (= A237), V244 (≠ L238), V266 (= V260), V268 (≠ L262)
- binding zinc ion: C38 (= C38), H59 (= H60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D152 (≠ C146)
Sites not aligning to the query:
4eezB Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1 (see paper)
34% identity, 77% coverage: 1:264/345 of query aligns to 1:266/342 of 4eezB
- active site: C39 (= C38), H40 (≠ R39), T41 (≠ S40), H44 (= H43), H60 (= H60), E61 (= E61), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), K109 (≠ R107), C147 (= C146), T151 (= T150)
- binding zinc ion: C39 (= C38), H60 (= H60), E61 (= E61), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), C147 (= C146)
Sites not aligning to the query:
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
31% identity, 90% coverage: 8:316/345 of query aligns to 12:319/347 of 3gfbA
- active site: C40 (= C38), G41 (≠ R39), T42 (≠ S40), H45 (vs. gap), H65 (= H60), E66 (= E61), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (≠ R107), P151 (≠ G143), A155 (≠ R147)
- binding nicotinamide-adenine-dinucleotide: G173 (= G171), G175 (= G173), P176 (≠ G174), L177 (≠ I175), S196 (≠ V193), E197 (≠ D194), P198 (≠ V195), R202 (≠ K199), F241 (≠ A237), S242 (≠ L238), A244 (≠ I240), L264 (≠ V260), G265 (= G261), L266 (= L262), I289 (≠ T287), T290 (≠ R288)
Sites not aligning to the query:
Query Sequence
>3607669 FitnessBrowser__Dino:3607669
MRAAVLRAYNEDLVLEDVPEPVCPEDGVVLKVLACGVCRSDWHGWVGEHPRVKPGQIGGH
EYCGEVIEAGPRAAFKPGDRVVAPFILACGSCPSCQAGAQNTCPNQRLPGFVEPGAFAEY
VAVPFDHNLSRLPDSLSPTVAAGLGCRVTTAWHALTGRAAVQGAEWVAVHGTGGIGLSSV
ILANALGARVIAVDVVDEKLTHAAQHGAEVTLNAREGDVAARIKQITGGGAHVAIEALGI
PETVNASLECLRPLGRHVQVGLPTGHTARMEINMSAIYQGNLAVYGTRGMPSWRYPSLLS
LIETGRVDMSPLIAREIGLSGTSAELRAFNGPTPPGVAVITDFQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory