Comparing 3607680 FitnessBrowser__Dino:3607680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
30% identity, 88% coverage: 25:316/330 of query aligns to 7:295/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
30% identity, 88% coverage: 25:316/330 of query aligns to 6:294/303 of 4p9kA
E1VBK1 Ectoine-binding periplasmic protein TeaA from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) (see 2 papers)
28% identity, 69% coverage: 96:324/330 of query aligns to 97:328/341 of E1VBK1
Sites not aligning to the query:
2vpnA High-resolution structure of the periplasmic ectoine- binding protein from teaabc trap-transporter of halomonas elongata (see paper)
28% identity, 69% coverage: 96:324/330 of query aligns to 68:299/306 of 2vpnA
Sites not aligning to the query:
2vpoA High resolution structure of the periplasmic binding protein teaa from teaabc trap transporter of halomonas elongata in complex with hydroxyectoine (see paper)
28% identity, 69% coverage: 96:324/330 of query aligns to 68:299/307 of 2vpoA
Sites not aligning to the query:
3gyyD The ectoine binding protein of the teaabc trap transporter teaa in the apo-state (see paper)
28% identity, 69% coverage: 96:324/330 of query aligns to 72:303/311 of 3gyyD
Sites not aligning to the query:
2vpnB High-resolution structure of the periplasmic ectoine- binding protein from teaabc trap-transporter of halomonas elongata (see paper)
28% identity, 69% coverage: 96:324/330 of query aligns to 72:303/310 of 2vpnB
Sites not aligning to the query:
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
24% identity, 97% coverage: 1:321/330 of query aligns to 1:321/329 of P44542
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
24% identity, 91% coverage: 26:324/330 of query aligns to 1:300/305 of 4mnpA
4n8gA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0660), target efi-501075, with bound d-alanine-d-alanine (see paper)
27% identity, 82% coverage: 48:317/330 of query aligns to 30:297/325 of 4n8gA
4mmpA Structure of sialic acid binding protein from pasturella multocida (see paper)
26% identity, 86% coverage: 41:325/330 of query aligns to 22:303/308 of 4mmpA
Sites not aligning to the query:
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
24% identity, 85% coverage: 42:321/330 of query aligns to 22:298/309 of 2v4cA
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
24% identity, 85% coverage: 42:321/330 of query aligns to 21:297/305 of 2cexB
Sites not aligning to the query:
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
24% identity, 85% coverage: 42:321/330 of query aligns to 21:297/304 of 2cexA
Sites not aligning to the query:
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
24% identity, 85% coverage: 42:321/330 of query aligns to 22:298/308 of 2wx9A
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
24% identity, 85% coverage: 42:321/330 of query aligns to 22:298/310 of 3b50A
Sites not aligning to the query:
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
24% identity, 85% coverage: 42:321/330 of query aligns to 22:298/308 of 2xwoA
Sites not aligning to the query:
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
24% identity, 98% coverage: 1:323/330 of query aligns to 13:330/336 of A3QCW5
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
28% identity, 88% coverage: 25:316/330 of query aligns to 4:292/301 of 4pdhA
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
26% identity, 83% coverage: 41:315/330 of query aligns to 18:289/300 of 4pf8A
Sites not aligning to the query:
>3607680 FitnessBrowser__Dino:3607680
MIRDTLILAACASVIGSAALATEKMRISLQLPLTSHLGENLQLFEKEVEERTGGAIDVEI
YDSATLYRDKEVPAAVGSGAIEAGVASLTQYVGDAPVVDVFYMPFLFNTEEKVRAAVAEG
SPVREILETEIAKTGGEVLYWQAYGGAILLSQDEPIRTPEDMQGKKARVFGKTLGDFVTA
AGGAPTLISGSEQYLAYQRGTVDVGMTGVSGVKSRKLWEVMDTITKTNHANIEFVVVVNS
DWWNGLDAETQGHINAAAQVAQDDVRDRMAAIEAEAYAAAEENGMTIVELTDEELAKWQA
VSQPVYDSYLAATGEAGRQILDALGVNSGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory