Comparing 3607727 FitnessBrowser__Dino:3607727 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1o9lA Succinate:coenzyme-a transferase (pig heart)
56% identity, 98% coverage: 3:229/231 of query aligns to 2:246/468 of 1o9lA
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
56% identity, 98% coverage: 3:229/231 of query aligns to 41:285/520 of Q29551
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
56% identity, 98% coverage: 3:229/231 of query aligns to 2:246/462 of 3oxoE
Sites not aligning to the query:
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
56% identity, 98% coverage: 3:229/231 of query aligns to 2:246/466 of 3k6mC
Sites not aligning to the query:
8i3yD Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
51% identity, 91% coverage: 22:231/231 of query aligns to 21:250/471 of 8i3yD
8i3yA Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
51% identity, 89% coverage: 22:227/231 of query aligns to 21:245/459 of 8i3yA
Sites not aligning to the query:
8i40A Crystal structure of asct from trypanosoma brucei in complex with coa.
51% identity, 89% coverage: 22:227/231 of query aligns to 21:245/467 of 8i40A
Sites not aligning to the query:
1k6dB Crystal structure of acetate coa-transferase alpha subunit (see paper)
41% identity, 87% coverage: 14:215/231 of query aligns to 13:214/219 of 1k6dB
2ahvA Crystal structure of acyl-coa transferase from e. Coli o157:h7 (ydif)- thioester complex with coa- 1 (see paper)
24% identity, 68% coverage: 59:215/231 of query aligns to 73:248/512 of 2ahvA
Sites not aligning to the query:
>3607727 FitnessBrowser__Dino:3607727
MQKIYGSAAEALEGLLFDDMLIAAGGFGLCGIPELLIEAVQKSGVKRLTIASNNAGVDDF
GLGLLLQTKQVKKMMSSYVGENDLFMQQYLSGELEIEFNPQGTLAERMRAGGCGIPGFYT
KTGVGTVIAEGKEHKDFNGETYILEEGIFADLSIVKAWKADETGNLVFRKTARNFNPPAA
MCGKVCVAEVEEIVPTGTLDPDTIHLPGIYVHRLVQGEHEKRIEQRTTRAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory