SitesBLAST
Comparing 3607773 FitnessBrowser__Dino:3607773 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P18079 5-aminolevulinate synthase; 5-aminolevulinic acid synthase; Delta-ALA synthase; Delta-aminolevulinate synthase; EC 2.3.1.37 from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) (see paper)
76% identity, 100% coverage: 1:407/407 of query aligns to 1:409/409 of P18079
- R21 (= R21) binding
- S137 (= S137) binding
- K156 (= K156) binding
- S189 (= S189) binding in other chain
- H217 (= H217) binding in other chain
- T245 (= T245) binding in other chain
- K248 (= K248) active site
- S277 (≠ T277) binding
- T278 (= T278) binding
- T365 (= T363) binding
2bwoB 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa (see paper)
75% identity, 97% coverage: 1:396/407 of query aligns to 1:398/399 of 2bwoB
- active site: N54 (= N54), H142 (= H142), E185 (= E185), S189 (= S189), D214 (= D214), H217 (= H217), K248 (= K248)
- binding pyridoxal-5'-phosphate: S114 (= S114), A115 (= A115), Y116 (= Y116), H142 (= H142), E185 (= E185), S189 (= S189), D214 (= D214), V216 (= V216), H217 (= H217), T245 (= T245), K248 (= K248)
- binding succinyl-coenzyme a: R21 (= R21), T83 (= T83), N85 (= N85), S137 (= S137), S139 (≠ A139), H142 (= H142), I146 (= I146), K150 (≠ R150), K156 (= K156), I158 (= I158), F276 (= F276), F363 (= F361), P364 (= P362), T365 (= T363)
2bwpA 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine (see paper)
75% identity, 97% coverage: 1:396/407 of query aligns to 1:398/398 of 2bwpA
- active site: N54 (= N54), H142 (= H142), E185 (= E185), S189 (= S189), D214 (= D214), H217 (= H217), K248 (= K248)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: N54 (= N54), A115 (= A115), Y116 (= Y116), H142 (= H142), E185 (= E185), D214 (= D214), V216 (= V216), H217 (= H217), T245 (= T245), K248 (= K248), S277 (≠ T277), T278 (= T278)
P22557 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Homo sapiens (Human) (see 11 papers)
52% identity, 98% coverage: 8:406/407 of query aligns to 151:551/587 of P22557
- K156 (≠ R13) to E: in SIDBA1; significantly reduced activity
- R170 (= R28) to H: in SIDBA1; significantly increased thermosensitivity
- R204 (≠ Q61) to Q: in SIDBA1; 15% to 35% activity of wild-type; dbSNP:rs1338391423
- R218 (≠ A75) to H: in SIDBA1; significantly increased thermosensitivity; dbSNP:rs185504937
- E242 (= E99) to K: in SIDBA1; significantly reduced activity
- C258 (≠ A115) binding in other chain
- F259 (≠ Y116) binding in other chain
- D263 (= D120) to N: in SIDBA1; significantly reduced activity
- P339 (= P196) to L: in SIDBA1; significantly reduced activity
- H360 (= H217) binding in other chain
- R375 (≠ K232) to C: in SIDBA1; significantly reduced activity
- T388 (= T245) binding in other chain
- K391 (= K248) modified: N6-(pyridoxal phosphate)lysine
- R411 (= R268) to C: in SIDBA1; 12% to 25% activity of wild-type; dbSNP:rs137852305; to H: in SIDBA1; significantly reduced activity
- T420 (= T277) binding
- T421 (= T278) binding
- R452 (≠ M307) to G: in SIDBA1; does not affect activity
- R511 (= R366) mutation to E: 2-fold increased enzyme activity with a lower specificity for glycine and higher for succinyl-CoA.
- P520 (= P375) to L: in SIDBA1; likely benign; associated in cis with H-560 in a patient; dbSNP:rs201062903
Sites not aligning to the query:
- 1:49 modified: transit peptide, Mitochondrion
- 560 R → H: in SIDBA1; associated in cis with L-520 in a patient; dbSNP:rs892041887
- 572 R → H: in SIDBA1; does not affect activity
- 586 Y → F: rare variant found in a congenital erythropoietic porphyria patient that also carries UROS mutations R-73 and Q-248; increased enzyme activity; dbSNP:rs139596860
P08680 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Mus musculus (Mouse) (see 2 papers)
51% identity, 98% coverage: 8:406/407 of query aligns to 151:551/587 of P08680
- K391 (= K248) modified: N6-(pyridoxal phosphate)lysine; mutation K->A,H: Abolishes enzyme activity.
Sites not aligning to the query:
- 1:49 modified: transit peptide, Mitochondrion
P09950 5-aminolevulinate synthase, mitochondrial; 5-aminolevulinic acid synthase; Delta-ALA synthase; Delta-aminolevulinate synthase; EC 2.3.1.37 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
50% identity, 99% coverage: 1:402/407 of query aligns to 71:491/548 of P09950
- G275 (= G208) mutation to R: Lethal in combination with a MCX1 disruption.
5txrA Structure of alas from s. Cerevisiae non-covalently bound to plp cofactor (see paper)
50% identity, 99% coverage: 1:402/407 of query aligns to 2:422/479 of 5txrA
- binding pyridoxal-5'-phosphate: C113 (≠ A115), Y114 (= Y116), H140 (= H142), E183 (= E185), D212 (= D214), V214 (= V216), H215 (= H217), T265 (= T245), K268 (= K248), T297 (= T277), T298 (= T278)
5qqrB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1171217421
52% identity, 97% coverage: 8:400/407 of query aligns to 15:404/429 of 5qqrB
- binding pyridoxal-5'-phosphate: S116 (= S114), C117 (≠ A115), F118 (≠ Y116), H144 (= H142), E187 (= E185), S191 (= S189), D216 (= D214), V218 (= V216), H219 (= H217), T247 (= T245), K250 (= K248), T279 (= T277), T280 (= T278)
Sites not aligning to the query:
5qrdB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1328968520
52% identity, 97% coverage: 8:400/407 of query aligns to 15:404/428 of 5qrdB
- binding pyridoxal-5'-phosphate: S116 (= S114), C117 (≠ A115), F118 (≠ Y116), N121 (= N119), H144 (= H142), E187 (= E185), D216 (= D214), V218 (= V216), H219 (= H217), T247 (= T245), K250 (= K248), T279 (= T277), T280 (= T278)
Sites not aligning to the query:
5qrbB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434868
52% identity, 97% coverage: 8:400/407 of query aligns to 15:404/428 of 5qrbB
- binding 1-ethyl-N-(2-fluorophenyl)piperidin-4-amine: W35 (≠ T29), A38 (= A32), F41 (≠ R35), D49 (= D47)
- binding pyridoxal-5'-phosphate: S116 (= S114), C117 (≠ A115), F118 (≠ Y116), H144 (= H142), E187 (= E185), S191 (= S189), D216 (= D214), V218 (= V216), H219 (= H217), T247 (= T245), K250 (= K248), T279 (= T277), T280 (= T278)
5qr8B Pandda analysis group deposition -- crystal structure of human alas2a in complex with z57258487
52% identity, 97% coverage: 8:400/407 of query aligns to 15:404/428 of 5qr8B
- binding pyridoxal-5'-phosphate: C117 (≠ A115), F118 (≠ Y116), H144 (= H142), E187 (= E185), S191 (= S189), D216 (= D214), V218 (= V216), H219 (= H217), T247 (= T245), K250 (= K248), T279 (= T277), T280 (= T278)
Sites not aligning to the query:
5qr7B Pandda analysis group deposition -- crystal structure of human alas2a in complex with z57299529
52% identity, 97% coverage: 8:400/407 of query aligns to 15:404/428 of 5qr7B
- binding ~{N}-(2-phenylethyl)-1~{H}-benzimidazol-2-amine: W35 (≠ T29), A38 (= A32), F41 (≠ R35), D49 (= D47), H207 (≠ D205), L212 (= L210), H239 (≠ D237), D242 (= D240), T262 (≠ S260)
- binding pyridoxal-5'-phosphate: C117 (≠ A115), F118 (≠ Y116), H144 (= H142), E187 (= E185), D216 (= D214), V218 (= V216), H219 (= H217), K250 (= K248), T279 (= T277), T280 (= T278)
5qr5B Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2241115980
52% identity, 97% coverage: 8:400/407 of query aligns to 15:404/428 of 5qr5B
- binding 1-[(furan-2-yl)methyl]-4-(methylsulfonyl)piperazine: W35 (≠ T29), F41 (≠ R35), D49 (= D47)
- binding pyridoxal-5'-phosphate: S116 (= S114), C117 (≠ A115), F118 (≠ Y116), N121 (= N119), H144 (= H142), E187 (= E185), S191 (= S189), D216 (= D214), V218 (= V216), H219 (= H217), K250 (= K248), T279 (= T277), T280 (= T278)
5qr4B Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434826
52% identity, 97% coverage: 8:400/407 of query aligns to 15:404/428 of 5qr4B
- binding [4-(propan-2-yl)piperazin-1-yl](thiophen-2-yl)methanone: W35 (≠ T29), D37 (= D31), A38 (= A32), F41 (≠ R35)
- binding pyridoxal-5'-phosphate: C117 (≠ A115), F118 (≠ Y116), N121 (= N119), H144 (= H142), E187 (= E185), S191 (= S189), D216 (= D214), V218 (= V216), H219 (= H217), T247 (= T245), K250 (= K248), T279 (= T277), T280 (= T278)
5qqzB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1675346324
52% identity, 97% coverage: 8:400/407 of query aligns to 15:404/428 of 5qqzB
- binding trans-3-[(2,6-dimethylpyrimidin-4-yl)(methyl)amino]cyclobutan-1-ol: W35 (≠ T29), D49 (= D47)
- binding pyridoxal-5'-phosphate: C117 (≠ A115), F118 (≠ Y116), N121 (= N119), H144 (= H142), E187 (= E185), D216 (= D214), V218 (= V216), H219 (= H217), K250 (= K248), T279 (= T277), T280 (= T278)
6hrhA Structure of human erythroid-specific 5'-aminolevulinate synthase, alas2
52% identity, 97% coverage: 8:400/407 of query aligns to 15:403/429 of 6hrhA
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ A115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qreA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z117233350
52% identity, 97% coverage: 8:400/407 of query aligns to 15:403/429 of 5qreA
- binding pyridoxal-5'-phosphate: C116 (≠ A115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
Sites not aligning to the query:
5qrcA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31721798
52% identity, 97% coverage: 8:400/407 of query aligns to 15:403/429 of 5qrcA
- binding 3-cyclohexyl-1-(morpholin-4-yl)propan-1-one: K129 (≠ I128), I130 (≠ L129), Y271 (= Y270)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ A115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), K249 (= K248), T278 (= T277), T279 (= T278)
5qraA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1101755952
52% identity, 97% coverage: 8:400/407 of query aligns to 15:403/429 of 5qraA
- binding [(4R)-4-methyl-2,3,4,5-tetrahydro-1H-azepin-1-yl](1,3-thiazol-4-yl)methanone: K129 (≠ I128), I130 (≠ L129), Y271 (= Y270)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ A115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qr9A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31478129
52% identity, 97% coverage: 8:400/407 of query aligns to 15:403/429 of 5qr9A
- binding ethyl benzylcarbamate: H206 (≠ D205), L211 (= L210), D241 (= D240)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ A115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), K249 (= K248), T278 (= T277), T279 (= T278)
Query Sequence
>3607773 FitnessBrowser__Dino:3607773
MDYTGHLDTALQRLHDEGRYRTFIDIARTKDAFPRAVWTRPDGQKQDITVWCGNDYLGMG
QHPVVLAAMHEALDATGAGSGGTRNISGTTVYHNALEEELADLHGKEAALLFTSAYIAND
ATLSTLPILFPGLHIISDALNHASMIQGIRHGNCPKHIFRHNDLTHLREILESLPADAPK
VIAFESVYSMDGDFGPIEAICDLADAFGALTYIDEVHAVGMYGPRGAGVCEKLGLMDRID
IINGTLGKAFGVMGGYIAASAKMVDAVRSYAPGFIFTTSIPPAVAAGAAASVRHLKTDTA
RREAHQMGAKILKMRLKGLGLPIIDHGSHIVPVHVGDPVKCKMISDRLLSEHGIYVQPIN
FPTVPRGTERLRFTPSPVHTPEMISKLVHAMDDLWSHCALSRRELSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory