Comparing 3607812 FitnessBrowser__Dino:3607812 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
27% identity, 79% coverage: 37:294/328 of query aligns to 5:263/302 of 8hkbA
7ndrD Crystal structure of tphc in an open conformation (see paper)
26% identity, 65% coverage: 34:245/328 of query aligns to 2:213/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
26% identity, 65% coverage: 34:245/328 of query aligns to 2:213/294 of 7ndsA
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
27% identity, 73% coverage: 33:270/328 of query aligns to 3:242/300 of 2dvzA
5okuA R. Palustris rpa4515 with adipate (see paper)
24% identity, 66% coverage: 30:247/328 of query aligns to 1:218/299 of 5okuA
Sites not aligning to the query:
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
24% identity, 66% coverage: 30:247/328 of query aligns to 1:218/299 of 5oeiA
Sites not aligning to the query:
2f5xB Structure of periplasmic binding protein bugd (see paper)
22% identity, 88% coverage: 33:322/328 of query aligns to 3:294/300 of 2f5xB
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
24% identity, 77% coverage: 45:296/328 of query aligns to 14:267/296 of 6hkeB
Sites not aligning to the query:
>3607812 FitnessBrowser__Dino:3607812
MTLNFTRRVALTIATAAATSIALPAFADDDWKPNKPIEMVIMAGQGGGADRLARLFQSII
QKENLASMPVLPVNKGGGSGAEALRYLKDKEGDSHVIMATLNSYYTTPIRTDIGVDIEEF
TPLARMALDTFVLWVNADSDIYTLEDYVAAVNASGGAWKMGGTGTGQEDSLVTAMLEKEF
GIKHTYVPFNGGGTVAKNLVGGHIDSTVNNPSEAMGFWQAGKVRPIAAFTPERLAVFPDV
PTATELGHESLVYWMQRSFVGPKDMPAEAVAYYTAMFEGLAQTEEWQTYTQEKALMADFL
TGDALQAYFLEERDKHAAILQEMEGTGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory