SitesBLAST
Comparing 3607819 FitnessBrowser__Dino:3607819 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
64% identity, 98% coverage: 2:714/724 of query aligns to 2:720/724 of 5vfbA
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
64% identity, 98% coverage: 2:714/724 of query aligns to 6:724/728 of 5oasA
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
60% identity, 98% coverage: 3:714/724 of query aligns to 5:726/729 of 6axeA
- active site: D272 (= D267), E274 (= E269), R338 (= R335), E437 (= E425), D465 (= D453), D636 (= D625)
- binding acetyl coenzyme *a: V119 (= V117), V120 (= V118), R126 (= R124), F127 (≠ Y125), N130 (= N128), A131 (= A129), R311 (= R308), R338 (= R335), M518 (= M506), W544 (= W532), P546 (= P534), P548 (= P536), C622 (= C611), K624 (= K613), M634 (= M623), D636 (= D625)
- binding magnesium ion: E437 (= E425), D465 (= D453)
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 4:723/741 of P9WK16
- R339 (= R335) active site, Proton acceptor
- D633 (= D625) active site, Proton donor
4ex4B The structure of glcb from mycobacterium leprae
59% identity, 98% coverage: 3:714/724 of query aligns to 2:720/721 of 4ex4B
- active site: D266 (= D267), E268 (= E269), R334 (= R335), E431 (= E425), D459 (= D453), D630 (= D625)
- binding magnesium ion: N290 (≠ M291), K291 (= K292), H371 (= H370), N379 (≠ G376), L382 (vs. gap), T383 (vs. gap), N384 (= N378), E431 (= E425), D459 (= D453)
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:716/720 of 2gq3A
- active site: D267 (= D267), E269 (= E269), R335 (= R335), E430 (= E425), D458 (= D453), D626 (= D625)
- binding coenzyme a: V114 (= V117), V115 (= V118), R121 (= R124), F122 (≠ Y125), N125 (= N128), A126 (= A129), K301 (= K301), R308 (= R308), P539 (= P534), P541 (= P536), C612 (= C611), M624 (= M623), D626 (= D625)
- binding magnesium ion: H370 (= H370), K373 (≠ G373), N378 (= N378), G379 (vs. gap), L381 (vs. gap), E430 (= E425), D458 (= D453)
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:707/711 of 6c2xA
- active site: D268 (= D267), E270 (= E269), R328 (= R335), E418 (= E425), D446 (= D453), D617 (= D625)
- binding (2S)-4-(2-bromo-6-methylphenyl)-2-hydroxy-4-oxobutanoic acid: V115 (= V117), R328 (= R335), E418 (= E425), G443 (= G450), L445 (= L452), D446 (= D453), M499 (= M506), W525 (= W532), M615 (= M623), D617 (= D625)
- binding magnesium ion: E418 (= E425), D446 (= D453)
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:707/711 of 5cjmA
- active site: D270 (= D267), E272 (= E269), R328 (= R335), E418 (= E425), D446 (= D453), D617 (= D625)
- binding 4h-thieno[3,2-b]pyrole-5-carboxylic acid: V117 (= V117), S274 (= S271), M499 (= M506), E616 (= E624), D617 (= D625)
- binding magnesium ion: E418 (= E425), D446 (= D453)
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:713/717 of 5c9rA
- active site: D270 (= D267), E272 (= E269), R331 (= R335), E424 (= E425), D452 (= D453), D623 (= D625)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V117), E424 (= E425), D452 (= D453), M505 (= M506), W531 (= W532), M621 (= M623), D623 (= D625)
- binding magnesium ion: E424 (= E425), D452 (= D453)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:712/716 of 6dkoA
- active site: D270 (= D267), E272 (= E269), R332 (= R335), E424 (= E425), D452 (= D453), D622 (= D625)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R335), G449 (= G450), L451 (= L452), D452 (= D453), M505 (= M506), W531 (= W532), M620 (= M623), D622 (= D625)
- binding magnesium ion: E424 (= E425), D452 (= D453)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:712/716 of 5drcA
- active site: D270 (= D267), E272 (= E269), R330 (= R335), E423 (= E425), D451 (= D453), D622 (= D625)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R335), E423 (= E425), G448 (= G450), L450 (= L452), D451 (= D453), M504 (= M506), W530 (= W532), M620 (= M623), D622 (= D625)
- binding magnesium ion: E423 (= E425), D451 (= D453), R468 (≠ P470), T471 (≠ E473)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:708/712 of 6dnpA
- active site: D270 (= D267), E272 (= E269), R328 (= R335), E419 (= E425), D447 (= D453), D618 (= D625)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R335), E419 (= E425), G444 (= G450), L446 (= L452), D447 (= D453), M500 (= M506), W526 (= W532), M616 (= M623), D618 (= D625)
- binding magnesium ion: E419 (= E425), D447 (= D453)
5t8gA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-oxo-4-((thiophene-2-carbonyl)oxy)butanoic acid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:710/714 of 5t8gA
- active site: D270 (= D267), E272 (= E269), R328 (= R335), E421 (= E425), D449 (= D453), D620 (= D625)
- binding (3E)-2-oxo-4-[(thiophen-2-ylcarbonyl)oxy]but-3-enoic acid: V117 (= V117), R328 (= R335), E421 (= E425), G446 (= G450), L448 (= L452), D449 (= D453), M502 (= M506), W528 (= W532), E619 (= E624), D620 (= D625)
- binding magnesium ion: E421 (= E425), D449 (= D453), R466 (≠ P470), T469 (≠ E473)
5dx7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(5-chlorothiophen-2-yl)isoxazole-3-carboxylic acid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:710/714 of 5dx7A
- active site: D270 (= D267), E272 (= E269), R328 (= R335), E421 (= E425), D449 (= D453), D620 (= D625)
- binding 5-(5-chlorothiophen-2-yl)-1,2-oxazole-3-carboxylic acid: V117 (= V117), M502 (= M506), M618 (= M623), D620 (= D625)
- binding magnesium ion: E421 (= E425), D449 (= D453)
5c9uA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-(2-(2,4-dichlorophenyl)hydrazinyl)-2-oxoacetic acid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:710/714 of 5c9uA
- active site: D270 (= D267), E272 (= E269), R328 (= R335), E421 (= E425), D449 (= D453), D620 (= D625)
- binding [2-(2,4-dichlorophenyl)hydrazinyl](oxo)acetic acid: E421 (= E425), G446 (= G450), L448 (= L452), D449 (= D453), M502 (= M506), W528 (= W532), M618 (= M623), E619 (= E624), D620 (= D625)
- binding magnesium ion: E421 (= E425), D449 (= D453)
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 2:708/712 of 6bu1A
- active site: D269 (= D267), E271 (= E269), R327 (= R335), E419 (= E425), D447 (= D453), D618 (= D625)
- binding (2Z)-4-(2-bromo-3-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V116 (= V117), R327 (= R335), E419 (= E425), G444 (= G450), L446 (= L452), D447 (= D453), M500 (= M506), W526 (= W532), M616 (= M623), D618 (= D625)
- binding magnesium ion: E419 (= E425), D447 (= D453), V463 (≠ L469), R464 (≠ P470)
6ba7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-cl-4-oh-phenyldiketoacid (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:705/709 of 6ba7A
- active site: D268 (= D267), E270 (= E269), R329 (= R335), E419 (= E425), D447 (= D453), D618 (= D625)
- binding (2Z)-4-(2-chloro-4-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V115 (= V117), R329 (= R335), G444 (= G450), L446 (= L452), D447 (= D453), M500 (= M506), W526 (= W532), D618 (= D625)
- binding magnesium ion: E419 (= E425), D447 (= D453)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
59% identity, 98% coverage: 3:714/724 of query aligns to 3:715/719 of 5cbiA
- active site: D270 (= D267), E272 (= E269), R331 (= R335), E426 (= E425), D454 (= D453), D625 (= D625)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L53), N54 (≠ A54), D57 (≠ T57), F125 (≠ Y125), Y138 (= Y138), D139 (= D139), Y142 (= Y142), M507 (= M506), W533 (= W532), P535 (= P534), A611 (≠ C611), M623 (= M623), M623 (= M623), E624 (= E624), D625 (= D625)
- binding magnesium ion: E426 (= E425), D454 (= D453)
5c9wA Crystal structure of mycobacterium tuberculosis malate synthase in complex with (z)-n-(2-bromophenyl)-2-(hydroxyimino)acetamide (see paper)
60% identity, 98% coverage: 3:714/724 of query aligns to 3:709/713 of 5c9wA
- active site: D269 (= D267), E271 (= E269), R327 (= R335), E420 (= E425), D448 (= D453), D619 (= D625)
- binding (2E)-N-(2-bromophenyl)-2-(hydroxyimino)acetamide: V116 (= V117), R327 (= R335), M501 (= M506), W527 (= W532), M617 (= M623), D619 (= D625)
- binding magnesium ion: E420 (= E425), D448 (= D453), V464 (≠ L469), R465 (≠ P470), T468 (≠ E473)
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
59% identity, 98% coverage: 3:714/724 of query aligns to 3:713/717 of 5cakA
- active site: D270 (= D267), E272 (= E269), R329 (= R335), E424 (= E425), D452 (= D453), D623 (= D625)
- binding (2R)-2-hydroxy-3-(1H-indol-3-yl)propanoic acid: V117 (= V117), L451 (= L452), M505 (= M506), E622 (= E624), D623 (= D625)
- binding magnesium ion: E424 (= E425), D452 (= D453)
Query Sequence
>3607819 FitnessBrowser__Dino:3607819
MKRVERAGLQVAPELVEFLETQALPGTGVTAAAFWEGLSALVHEEGPTNRALLAKRTELQ
RKIDAWHVARKGQPHDAAAYAAFLREIGYLVPEPEDFEIDTANVDPEIATIPGPQLVVPI
TNARYALNAANARWGSLYDALYGTDALGDLPSGKGFDPERGARVMAWARDHLDHAAPIAG
VSWADVTRIDVADGALELVAGDLRPLVDPAQFAGYTTGPAGDVTSVLLRKNGLHLRVMID
PTSRIGAADPAGISDVIIEAAISAIMDCEDSVAAVDAEDKVLAYGNWLGLMKGDLSQEVT
KGGKSFTRALARDVVATAPNGDRLVLKGRALMLVRNVGHLMTNPAILDRDGAEIGEGLMD
AMVTTLIAMHDLGRAGGNSVHGSVYVVKPKMHGPEEVAFTDRIFTRVEAALGLPANTVKI
GIMDEERRTSANLKACIHAARSRVAFINTGFLDRTGDEIHTSMEAGPVLPKGEMKGTAWI
AAYEDRNVDIGLACGLKGRAQIGKGMWAMPDLMADMLEAKIGHPMSGANCAWVPSPTAAT
LHATHYHKVDVFARQDEIAAGGARGTLEDLLTIPLLEGRSLSAAEIAAEVENNAQGILGY
VVRWIDQGVGCSKVPDIHDVGLMEDRATCRISSQALANWLHHGIVSEEQVMGALRKMAAV
VDQQNAGDPAYRPMAPGFDGIAFAAACDLVFAGREQPSGYTEPVLHARRLELKAALVAPE
ALRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory