Comparing 3607821 FitnessBrowser__Dino:3607821 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
39% identity, 97% coverage: 1:250/259 of query aligns to 6:255/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
39% identity, 95% coverage: 4:250/259 of query aligns to 4:249/249 of 7d53A
7d4rB Spua native structure (see paper)
35% identity, 92% coverage: 4:242/259 of query aligns to 2:209/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 1:244/259 of query aligns to 5:245/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
33% identity, 94% coverage: 1:244/259 of query aligns to 3:243/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
30% identity, 92% coverage: 3:239/259 of query aligns to 2:216/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 86% coverage: 35:257/259 of query aligns to 99:308/308 of O33341
>3607821 FitnessBrowser__Dino:3607821
MSRPVVGIIGNSYLINDEYPAHAGGSMNSCAVSKVAGAIPFIVPTDPTLVSVDELLEVCD
GFVLTGARANVHPEEYGHQPTDKHGDFDRDRDRITLPLVRACVERGQPFLGICRGFQEVN
VAMGGTLHPEIRELPGRINHRMPPEGTLEEKFEIRQTVTVSPGGPFARVFGATQVRTNTL
HGQGIMDPGTRVVIDGHAEDGTPEAIYIADAPGFTLSVQWHPEWNADRDPVSRPLFTAFG
EAVRAWADGRRPVAVARSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory