Comparing 3607822 FitnessBrowser__Dino:3607822 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
47% identity, 99% coverage: 4:393/393 of query aligns to 20:416/416 of P83788
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
48% identity, 96% coverage: 4:381/393 of query aligns to 19:403/404 of 1qz9A
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
28% identity, 90% coverage: 11:365/393 of query aligns to 61:433/446 of 3e9kA
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
27% identity, 94% coverage: 11:378/393 of query aligns to 66:460/464 of P70712
Sites not aligning to the query:
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
28% identity, 90% coverage: 11:365/393 of query aligns to 66:447/465 of Q16719
Sites not aligning to the query:
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
28% identity, 90% coverage: 11:365/393 of query aligns to 61:434/447 of 2hzpA
Q93WX6 Cysteine desulfurase 1, chloroplastic; NIFS-like protein 1; CpNifS1; Plastid sufS-like protein; Protein AtCpNifS; Selenocysteine lyase; EC 2.8.1.7; EC 4.4.1.16 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 79% coverage: 13:324/393 of query aligns to 73:390/463 of Q93WX6
Sites not aligning to the query:
8odqD Sufs-sufu complex from mycobacterium tuberculosis (see paper)
30% identity, 55% coverage: 141:355/393 of query aligns to 161:376/410 of 8odqD
Sites not aligning to the query:
7tlmA Structure of atopobium parvulum sufs (see paper)
24% identity, 52% coverage: 94:296/393 of query aligns to 113:316/415 of 7tlmA
Sites not aligning to the query:
Q9EXP2 Cysteine desulfurase; Selenocysteine beta-lyase; SCL; Selenocysteine lyase; Selenocysteine reductase; EC 2.8.1.7; EC 4.4.1.16 from Dickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937)) (see paper)
27% identity, 67% coverage: 63:324/393 of query aligns to 80:342/412 of Q9EXP2
Sites not aligning to the query:
7tlpB Structure of atopobium parvulum sufs k235r (see paper)
24% identity, 52% coverage: 94:296/393 of query aligns to 106:298/393 of 7tlpB
Sites not aligning to the query:
7tlpA Structure of atopobium parvulum sufs k235r (see paper)
24% identity, 52% coverage: 94:296/393 of query aligns to 104:296/391 of 7tlpA
Sites not aligning to the query:
5ft8A Crystal structure of the complex between the cysteine desulfurase csda and the sulfur-acceptor csde in the persulfurated state at 2.50 angstroem resolution
24% identity, 80% coverage: 62:377/393 of query aligns to 70:397/401 of 5ft8A
Q46925 Cysteine desulfurase CsdA; Cysteine sulfinate desulfinase; CSD; Selenocysteine lyase; EC 2.8.1.7; EC 3.13.1.-; EC 4.4.1.16 from Escherichia coli (strain K12) (see 2 papers)
24% identity, 80% coverage: 62:377/393 of query aligns to 70:397/401 of Q46925
1t3iA Structure of slr0077/sufs, the essential cysteine desulfurase from synechocystis pcc 6803 (see paper)
23% identity, 48% coverage: 141:328/393 of query aligns to 158:338/406 of 1t3iA
Sites not aligning to the query:
>3607822 FitnessBrowser__Dino:3607822
MLRRDAFDLPEGVIYLDGNSLGPLPRRAEAAVARAMQAEWGAMLIRGWNEAGWMDQPDRL
GDRIAPLIGAAPGTVTVGETLSIRVFQGLAAALSLRPGRKVILTEAGNFPSDLYMAQGLI
DALGQGHVLRALPATEIPAALTDEVAVLMLTEVDYRSGARHDMAALTAQAHGVGALTLWD
LAHSAGALPVALTRCNADFAAGCTYKYLNGGPGAPAFFYARPDHSEITRPILAGWLGHAA
PFDFAPDYAPGPGRARFRIGTPPVLQMAALDAALDIFDGVDIAALHARAIVLADRLATGF
EAVCPDLRRLTPMDPARRGSQIAFAHPNGYAMVQALIAQGVIGDFRAPDILRFGLTPLYL
DAGDIDTAIERFAQVIEGRLWDDPAYRTRNKVT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory