SitesBLAST
Comparing 3607835 FitnessBrowser__Dino:3607835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
50% identity, 97% coverage: 5:253/258 of query aligns to 7:256/258 of 5wjsA
- active site: G27 (= G25), S152 (= S149), Y162 (= Y159), Y165 (= Y162), K169 (≠ N166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G21), T26 (≠ S24), I28 (= I26), D47 (≠ G45), L48 (≠ R46), D73 (= D70), L74 (≠ I71), N100 (= N97), A102 (= A99), L150 (≠ F147), G151 (≠ S148), S152 (= S149), K169 (≠ N166), P195 (= P192), G196 (= G193), W197 (= W194), V198 (= V195), K202 (= K199)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
46% identity, 97% coverage: 7:255/258 of query aligns to 4:254/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G21), T21 (≠ S24), I23 (= I26), D42 (vs. gap), I43 (= I44), C68 (≠ G69), D69 (= D70), L70 (≠ I71), N96 (= N97), A98 (= A99), F146 (= F147), S147 (= S148), S148 (= S149), Y161 (= Y162), K165 (≠ N166), P191 (= P192), G192 (= G193), W193 (= W194), V194 (= V195), R198 (≠ K199)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 95% coverage: 12:256/258 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G25), S142 (= S149), Q152 (≠ Y159), Y155 (= Y162), K159 (≠ N166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (≠ G23), R15 (≠ S24), G16 (= G25), I17 (= I26), N35 (≠ I44), Y36 (vs. gap), N37 (vs. gap), G38 (= G45), S39 (≠ R46), N63 (≠ D70), V64 (≠ I71), N90 (= N97), A91 (= A98), I93 (≠ N100), I113 (= I120), S142 (= S149), Y155 (= Y162), K159 (≠ N166), P185 (= P192), I188 (≠ V195), T190 (= T197)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 93% coverage: 18:256/258 of query aligns to 11:244/244 of 4nbuB
- active site: G18 (= G25), N111 (= N121), S139 (= S149), Q149 (≠ Y159), Y152 (= Y162), K156 (≠ N166)
- binding acetoacetyl-coenzyme a: D93 (≠ R103), K98 (≠ E108), S139 (= S149), N146 (= N156), V147 (≠ A157), Q149 (≠ Y159), Y152 (= Y162), F184 (≠ W194), M189 (≠ K199), K200 (≠ H213)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G21), N17 (≠ S24), G18 (= G25), I19 (= I26), D38 (= D48), F39 (≠ A49), V59 (≠ G69), D60 (= D70), V61 (≠ I71), N87 (= N97), A88 (= A98), G89 (≠ A99), I90 (≠ N100), T137 (≠ F147), S139 (= S149), Y152 (= Y162), K156 (≠ N166), P182 (= P192), F184 (≠ W194), T185 (≠ V195), T187 (= T197), M189 (≠ K199)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
38% identity, 97% coverage: 8:256/258 of query aligns to 5:253/254 of 3lqfA
- active site: G22 (= G25), S144 (= S149), Y159 (= Y162), K163 (≠ N166)
- binding meso-erythritol: N151 (= N156), Y159 (= Y162), Y191 (≠ W194), T197 (≠ Q200), M200 (= M203)
- binding nicotinamide-adenine-dinucleotide: G18 (= G21), S21 (= S24), G22 (= G25), I23 (= I26), D42 (≠ G45), R43 (= R46), D66 (= D70), V67 (≠ I71), S92 (≠ N97), L142 (≠ F147), S144 (= S149), K163 (≠ N166), P189 (= P192), V192 (= V195), T194 (= T197), M196 (≠ K199), T197 (≠ Q200)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
38% identity, 97% coverage: 8:256/258 of query aligns to 5:253/254 of 2wsbA
- active site: G22 (= G25), S144 (= S149), Y159 (= Y162), K163 (≠ N166)
- binding nicotinamide-adenine-dinucleotide: G18 (= G21), S21 (= S24), G22 (= G25), I23 (= I26), D42 (≠ G45), R43 (= R46), D66 (= D70), V67 (≠ I71), S92 (≠ N97), A93 (= A98), L142 (≠ F147), S144 (= S149), Y159 (= Y162), K163 (≠ N166), P189 (= P192), V192 (= V195), T194 (= T197), M196 (≠ K199), T197 (≠ Q200)
- binding n-propanol: S144 (= S149), M145 (≠ I150), N151 (= N156), N151 (= N156), Y159 (= Y162), Y159 (= Y162), Y191 (≠ W194)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
38% identity, 97% coverage: 8:256/258 of query aligns to 5:253/254 of 2wdzA
- active site: G22 (= G25), S144 (= S149), Y159 (= Y162), K163 (≠ N166)
- binding (2S)-pentane-1,2-diol: A45 (≠ D48), D49 (≠ F52), R62 (≠ L65), S146 (= S151), Y159 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G18 (= G21), S21 (= S24), G22 (= G25), I23 (= I26), D42 (≠ G45), R43 (= R46), A65 (≠ G69), D66 (= D70), V67 (≠ I71), S92 (≠ N97), A93 (= A98), L142 (≠ F147), S144 (= S149), Y159 (= Y162), K163 (≠ N166), P189 (= P192), V192 (= V195), T194 (= T197), M196 (≠ K199), T197 (≠ Q200)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
38% identity, 97% coverage: 8:256/258 of query aligns to 5:253/254 of C0KTJ6
Sites not aligning to the query:
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 93% coverage: 16:254/258 of query aligns to 3:237/239 of 3sj7A
- active site: G12 (= G25), S138 (= S149), Q148 (≠ Y159), Y151 (= Y162), K155 (≠ N166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G21), S10 (≠ G23), R11 (≠ S24), I13 (= I26), N31 (vs. gap), Y32 (≠ F43), A33 (≠ I44), G34 (= G45), S35 (≠ R46), A58 (≠ G69), N59 (≠ D70), V60 (≠ I71), N86 (= N97), A87 (= A98), T109 (≠ I120), S138 (= S149), Y151 (= Y162), K155 (≠ N166), P181 (= P192), G182 (= G193)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 93% coverage: 16:254/258 of query aligns to 6:244/246 of 3osuA
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
34% identity, 97% coverage: 8:256/258 of query aligns to 1:253/254 of 4fn4A
- active site: G18 (= G25), S144 (= S149), Y157 (= Y162), K161 (≠ N166), S202 (≠ K199)
- binding nicotinamide-adenine-dinucleotide: G14 (= G21), S17 (= S24), G18 (= G25), I19 (= I26), E38 (≠ I44), L39 (≠ G45), R43 (≠ A49), A63 (≠ G69), D64 (= D70), V65 (≠ I71), N91 (= N97), G93 (≠ A99), I94 (vs. gap), T142 (≠ F147), S144 (= S149), Y157 (= Y162), K161 (≠ N166), P187 (= P192), V190 (= V195), T192 (= T197), N193 (vs. gap), I194 (vs. gap)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
33% identity, 92% coverage: 18:254/258 of query aligns to 9:241/244 of 6wprA
- active site: G16 (= G25), S138 (= S149), Y151 (= Y162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (≠ G23), R15 (≠ S24), T37 (≠ D48), L58 (≠ G69), D59 (= D70), V60 (≠ I71), N86 (= N97), A87 (= A98), G88 (≠ A99), I89 (≠ N100), I136 (≠ F147), Y151 (= Y162), K155 (≠ N166), P181 (= P192)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
33% identity, 92% coverage: 18:254/258 of query aligns to 9:241/244 of 6t62A
- active site: G16 (= G25), S138 (= S149), Y151 (= Y162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (≠ G23), R15 (≠ S24), A36 (≠ S47), T37 (≠ D48), L58 (≠ G69), D59 (= D70), V60 (≠ I71), N86 (= N97), A87 (= A98), G88 (≠ A99), I89 (≠ N100), I136 (≠ F147), S137 (= S148), S138 (= S149), Y151 (= Y162), K155 (≠ N166), P181 (= P192), G182 (= G193), I184 (≠ V195), M188 (= M203)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
36% identity, 94% coverage: 11:253/258 of query aligns to 3:237/241 of 5t2uA
- active site: G17 (= G25), T135 (≠ S149), T145 (≠ Y159), Y148 (= Y162), K152 (≠ N166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G21), G17 (= G25), R38 (= R46), D39 (≠ S47), R42 (≠ S50), D60 (= D70), L61 (≠ I71), N83 (= N97), A84 (= A98), Y87 (≠ D101), I133 (≠ F147), T135 (≠ S149), Y148 (= Y162), K152 (≠ N166), P178 (= P192), P180 (≠ W194), T181 (≠ V195), T183 (= T197), T185 (≠ K199), T186 (≠ Q200)
P73826 Acetoacetyl-CoA reductase; EC 1.1.1.36 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
35% identity, 93% coverage: 12:252/258 of query aligns to 6:236/240 of P73826
- S134 (= S149) mutation to A: 12% enzymatic activity.
- Y147 (= Y162) mutation to A: No enzymatic activity.
- K151 (≠ N166) mutation to A: 5% enzymatic activity.
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
35% identity, 94% coverage: 12:253/258 of query aligns to 2:256/260 of 2ztlA
- active site: G15 (= G25), N114 (= N121), S142 (= S149), Y155 (= Y162), K159 (≠ N166), L200 (≠ W204)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ D101), S142 (= S149), H144 (≠ S151), K152 (≠ Y159), Y155 (= Y162), Q196 (= Q200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G21), G15 (= G25), I16 (= I26), F36 (≠ R46), L64 (≠ I71), N90 (= N97), A91 (= A98), G92 (≠ A99), L113 (≠ I120), Y155 (= Y162), K159 (≠ N166), P185 (= P192), W187 (= W194), V188 (= V195), T190 (= T197), V193 (vs. gap)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
35% identity, 94% coverage: 12:253/258 of query aligns to 2:256/260 of 1wmbA
Sites not aligning to the query:
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
31% identity, 94% coverage: 11:253/258 of query aligns to 7:243/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G21), D19 (≠ G23), L22 (≠ I26), I42 (≠ R46), D65 (= D70), M66 (≠ I71), N92 (= N97), A93 (= A98), G94 (≠ A99), L115 (≠ I120), I143 (≠ F147), S145 (= S149), Y158 (= Y162), K162 (≠ N166), G189 (= G193), M191 (≠ V195), T193 (= T197), N195 (≠ K199)
Q920P0 L-xylulose reductase; XR; Dicarbonyl/L-xylulose reductase; EC 1.1.1.10 from Rattus norvegicus (Rat) (see paper)
36% identity, 95% coverage: 12:257/258 of query aligns to 5:244/244 of Q920P0
- S136 (= S149) mutation to A: Loss of activity.
- Q137 (≠ I150) mutation to M: Slightly reduced activity. Loss of activity for sugars; when associated with F-143 and L-146.
- L143 (≠ N156) mutation to F: Slightly reduced activity. Loss of activity for sugars; when associated with M-137 and L-146.
- H146 (≠ Y159) mutation to L: Slightly reduced activity. Loss of activity for sugars; when associated with M-137; F-143 and L-146.
- Y149 (= Y162) mutation to F: Loss of activity.
- K153 (≠ N166) mutation to M: Loss of activity.
- N190 (≠ M203) mutation to V: Slightly reduced activity. Loss of activity for sugars; when associated with S-191.
- W191 (= W204) mutation to F: Slightly reduced activity.; mutation to S: Slightly reduced activity. Loss of activity for sugars; when associated with V-190.
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
33% identity, 93% coverage: 18:257/258 of query aligns to 9:251/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), Q15 (≠ S24), G16 (= G25), I17 (= I26), D36 (≠ F43), V63 (≠ I71), N89 (= N97), A91 (= A99), S94 (vs. gap), I142 (≠ F147), S143 (= S148), S144 (= S149), Y157 (= Y162), K161 (≠ N166), P187 (= P192), H188 (≠ G193), I190 (≠ V195), I194 (≠ K199)
Query Sequence
>3607835 FitnessBrowser__Dino:3607835
MPAPRNATFHDLDGASVFVTGGGSGIGAALTDGFLAQGAQVAFIGRSDASAFVAKMRAAH
GRAPLFVQGDITDTDALRAAIAQATAAHGPITALVNNAANDKRHSTAEVTPEFWDQMQAI
NLKAYFFAAQAVTPGMAEAGGGAIVNFSSISYMMGNAGYPAYTAANAGITGLTRSLAREF
GPDGIRVNALAPGWVLTPKQLEMWATPEDLAAHLDRQCLKTHLAPEDIVEATLFLASGAS
KMMTGQCMVVDGGVVVTG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory