SitesBLAST
Comparing 3607857 FitnessBrowser__Dino:3607857 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
32% identity, 95% coverage: 1:312/327 of query aligns to 3:323/340 of 4n54A
- active site: K96 (= K91), H183 (= H172)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R10), K96 (= K91), D156 (= D150), D179 (= D168), M180 (= M169), H183 (= H172), R238 (= R227), Y244 (= Y233)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ L6), G9 (= G7), L10 (≠ C8), G11 (= G9), R12 (= R10), L13 (≠ I11), S35 (≠ D32), V36 (≠ A33), E40 (≠ A37), S73 (≠ T68), P74 (= P69), F77 (≠ L72), H78 (= H73), E95 (= E90), K96 (= K91), M125 (≠ N119), F167 (vs. gap), F284 (= F273)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
28% identity, 100% coverage: 1:327/327 of query aligns to 5:340/342 of 3ceaA
- active site: K98 (= K91), H185 (= H172)
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), G13 (= G9), R14 (= R10), L15 (≠ I11), L38 (≠ A33), Q42 (≠ A37), V74 (≠ A67), A75 (≠ T68), P76 (= P69), T77 (= T70), F79 (≠ L72), H80 (= H73), M83 (≠ Q76), E97 (= E90), K98 (= K91), M127 (≠ N119), F169 (vs. gap), H185 (= H172), F286 (= F273)
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
24% identity, 100% coverage: 1:327/327 of query aligns to 2:338/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), H11 (≠ R10), M12 (≠ I11), D33 (= D32), P34 (≠ A33), T35 (≠ V34), S38 (≠ A37), A71 (= A67), S72 (≠ T68), P73 (= P69), N74 (≠ T70), H77 (= H73), E96 (= E90), K97 (= K91), E125 (≠ N119), K162 (≠ P155), V163 (≠ I156), W166 (vs. gap)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
29% identity, 99% coverage: 1:323/327 of query aligns to 3:322/336 of 3ec7A
- active site: K97 (= K91), H176 (= H172)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), M12 (≠ R10), I13 (= I11), D35 (= D32), I36 (≠ A33), R40 (≠ A37), T73 (≠ A67), A74 (≠ T68), S75 (≠ P69), N76 (≠ T70), H79 (= H73), E96 (= E90), K97 (= K91), M126 (≠ N119), W271 (vs. gap), Y279 (= Y281)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
31% identity, 75% coverage: 1:246/327 of query aligns to 3:270/372 of 6a3iA
- binding Levoglucosan: K103 (= K91), Y132 (≠ R120), Y160 (≠ M143), Q162 (≠ V145), R175 (≠ Y158), D188 (= D168), H192 (= H172)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (≠ R10), M13 (≠ I11), E42 (≠ D32), A43 (= A33), P81 (= P69), N82 (≠ T70), L84 (= L72), H85 (= H73), E102 (= E90), K103 (= K91), W174 (≠ S157), R175 (≠ Y158)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
30% identity, 76% coverage: 2:250/327 of query aligns to 2:253/332 of 2glxA
- active site: K93 (= K91), H179 (= H172)
- binding acetate ion: K93 (= K91), H179 (= H172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), A8 (≠ C8), S9 (≠ G9), T10 (≠ R10), I11 (= I11), S32 (≠ D32), T33 (≠ A33), R37 (vs. gap), S69 (≠ A67), T70 (= T68), N72 (≠ T70), H75 (= H73), E92 (= E90), K93 (= K91), H121 (≠ N119), W161 (≠ I159), R162 (vs. gap)
Sites not aligning to the query:
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
24% identity, 99% coverage: 1:323/327 of query aligns to 3:323/337 of 3nt5A
- active site: K97 (= K91), H176 (= H172)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K91), H155 (≠ S148), H176 (= H172), Y235 (= Y233)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G11 (= G9), A12 (≠ R10), I13 (= I11), D35 (= D32), V36 (≠ A33), S74 (≠ T68), W75 (≠ P69), G76 (≠ T70), E96 (= E90), K97 (= K91), Y280 (= Y281)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
24% identity, 99% coverage: 1:323/327 of query aligns to 3:323/337 of 3nt4A
- active site: K97 (= K91), H176 (= H172)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ S148), H176 (= H172), Y235 (= Y233), W272 (≠ F273)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G9), A12 (≠ R10), I13 (= I11), D35 (= D32), V36 (≠ A33), S74 (≠ T68), W75 (≠ P69), G76 (≠ T70), E96 (= E90), K97 (= K91), H176 (= H172)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 99% coverage: 1:323/327 of query aligns to 3:323/337 of 3nt2B
- active site: K97 (= K91), H176 (= H172)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G7), G11 (= G9), A12 (≠ R10), D35 (= D32), V36 (≠ A33), S74 (≠ T68), W75 (≠ P69), A78 (≠ L72), K97 (= K91), W272 (≠ F273), Y280 (= Y281)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 99% coverage: 1:323/327 of query aligns to 3:323/337 of 3nt2A
- active site: K97 (= K91), H176 (= H172)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G11 (= G9), A12 (≠ R10), I13 (= I11), D35 (= D32), V36 (≠ A33), S74 (≠ T68), W75 (≠ P69), G76 (≠ T70), A78 (≠ L72), H79 (= H73), E96 (= E90), K97 (= K91), H176 (= H172), Y280 (= Y281)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
24% identity, 99% coverage: 1:323/327 of query aligns to 3:323/337 of 4l8vA
- active site: K97 (= K91), H176 (= H172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R10), I13 (= I11), S74 (≠ T68), W75 (≠ P69), H79 (= H73), E96 (= E90), K97 (= K91), M126 (≠ N119), W272 (≠ F273), Y280 (= Y281)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
30% identity, 76% coverage: 2:250/327 of query aligns to 3:254/333 of Q2I8V6
- ASTI 9:12 (≠ CGRI 8:11) binding
- S10 (≠ G9) mutation to G: Almost no effect.
- A13 (≠ G12) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ D32) mutation to D: No activity.
- ST 33:34 (≠ DA 32:33) binding
- R38 (vs. gap) binding
- TTNELH 71:76 (≠ TPTTLH 68:73) binding
- EK 93:94 (= EK 90:91) binding
- K94 (= K91) mutation to G: Less than 1% remaining activity.
- N120 (≠ A117) binding
- WR 162:163 (≠ I- 159) binding
- D176 (= D168) mutation to A: Less than 1% remaining activity.
- H180 (= H172) mutation to A: Less than 2% remaining activity.
- G206 (= G201) mutation to I: No effect.
Sites not aligning to the query:
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
31% identity, 75% coverage: 1:246/327 of query aligns to 2:274/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G9), F11 (≠ R10), M12 (≠ I11), E41 (≠ D32), T79 (= T68), P80 (= P69), N81 (≠ T70), H84 (= H73), E101 (= E90), K102 (= K91), W173 (≠ S157), R174 (≠ Y158)
- binding alpha-L-sorbopyranose: K102 (= K91), Y131 (≠ R120), Y159 (≠ M143), Q161 (≠ V145), W163 (≠ T147), R174 (≠ Y158), D187 (= D168)
P39353 2,7-anhydro-N-acetylneuraminate hydratase; EcNanOx; EC 4.2.1.- from Escherichia coli (strain K12) (see paper)
28% identity, 76% coverage: 1:247/327 of query aligns to 2:250/372 of P39353
- Y11 (≠ R10) binding
- F12 (≠ I11) binding
- D33 (= D32) binding
- N36 (≠ A37) binding
- T68 (= T68) binding
- N70 (≠ T70) binding
- H73 (= H73) binding
- E90 (= E90) binding
- K91 (= K91) binding
- W160 (≠ Y158) binding
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
28% identity, 76% coverage: 1:247/327 of query aligns to 2:250/355 of 6o15A
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), Y11 (≠ R10), F12 (≠ I11), Y32 (≠ A31), D33 (= D32), A67 (= A67), T68 (= T68), P69 (= P69), N70 (≠ T70), H73 (= H73), E90 (= E90), K91 (= K91), I119 (≠ N119), W160 (≠ Y158)
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
30% identity, 75% coverage: 1:246/327 of query aligns to 4:286/390 of F0M433
- F13 (≠ R10) binding
- M14 (≠ I11) binding
- E43 (≠ D32) binding
- T81 (= T68) binding
- N83 (≠ T70) binding
- H86 (= H73) binding
- E103 (= E90) binding
- K104 (= K91) binding ; binding
- A130 (= A117) binding
- N132 (= N119) binding
- Y133 (≠ R120) binding
- Q163 (≠ V145) binding
- W175 (≠ S157) binding
- R176 (≠ Y158) binding ; binding
- D189 (= D168) binding
- H193 (= H172) binding
Sites not aligning to the query:
8qc8B Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
26% identity, 76% coverage: 1:247/327 of query aligns to 6:268/367 of 8qc8B
- binding nicotinamide-adenine-dinucleotide: H15 (≠ R10), M16 (≠ I11), D37 (= D32), P38 (≠ A33), T39 (≠ V34), S42 (≠ A37), A75 (= A67), S76 (≠ T68), P77 (= P69), N78 (≠ T70), H81 (= H73), E100 (= E90), K101 (= K91), E129 (≠ N119), K166 (≠ P155), V167 (≠ I156), W170 (vs. gap)
Sites not aligning to the query:
8qc2A Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ and sulfoquinovose (sq) (see paper)
26% identity, 76% coverage: 1:247/327 of query aligns to 4:266/363 of 8qc2A
- binding nicotinamide-adenine-dinucleotide: G12 (= G9), H13 (≠ R10), M14 (≠ I11), D35 (= D32), P36 (≠ A33), T37 (≠ V34), S40 (≠ A37), A73 (= A67), S74 (≠ T68), P75 (= P69), N76 (≠ T70), H79 (= H73), E98 (= E90), K99 (= K91), E127 (≠ N119), K164 (≠ P155), V165 (≠ I156), W168 (vs. gap)
- binding sulfoquinovose: K99 (= K91), Y128 (≠ R120), R158 (= R149), F161 (≠ A152), L162 (≠ P153), K164 (≠ P155), E181 (≠ D168), H185 (= H172)
Sites not aligning to the query:
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
28% identity, 91% coverage: 1:297/327 of query aligns to 3:298/339 of 4mjlD
- active site: K97 (= K91)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K91), H155 (≠ R149), N157 (≠ P153), D172 (= D168), T173 (≠ M169), H176 (= H172), Y236 (= Y233)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), A12 (≠ R10), M13 (≠ I11), D35 (= D32), I36 (≠ A33), V73 (≠ A67), S74 (≠ T68), H79 (= H73), E96 (= E90), K97 (= K91), M126 (≠ N119), D172 (= D168), W274 (≠ F273), Y282 (= Y281)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 91% coverage: 1:297/327 of query aligns to 3:298/339 of 4mioD
- active site: K97 (= K91)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K91), H155 (≠ R149), N157 (≠ P153), D172 (= D168), T173 (≠ M169), H176 (= H172), Y236 (= Y233)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R10), M13 (≠ I11), D35 (= D32), I36 (≠ A33), S74 (≠ T68), A78 (≠ L72), H79 (= H73), E96 (= E90), K97 (= K91), M126 (≠ N119), D172 (= D168), W274 (≠ F273), Y282 (= Y281)
Query Sequence
>3607857 FitnessBrowser__Dino:3607857
MKLGLLGCGRIGQVHARSLSRIAEARLVAVADAVPEAAQALAARAGAEVRGSEEIITAPD
IDAVIVATPTTLHFEQIHAIAAAGKAIFCEKPIDLSAERAAQCQQAVEAAGVPFLTAFNR
RFDPSFAHLHDQVRDGAIGEIEMVVITSRDPAPPPISYIESSGGLFRDMMIHDFDMARFL
LGEEPAEIHAFGSCLVDPAIGAAGDIDTAMVTLRTASGRLCQINNSRRATYGYDQRIEVH
GSKGMLQAANQPAHLVTQASGGGFTAARSMDFFLERYEAAYLAEMTHFVDAVTRGSPLKA
TIADGVAAQRLADTADTARKTGKVLSL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory