Comparing 3607860 FitnessBrowser__Dino:3607860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
28% identity, 83% coverage: 43:318/333 of query aligns to 31:309/310 of 5yggA
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
27% identity, 83% coverage: 43:318/333 of query aligns to 27:305/306 of 5eynA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 84% coverage: 38:318/333 of query aligns to 28:301/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
30% identity, 84% coverage: 38:318/333 of query aligns to 28:301/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
29% identity, 84% coverage: 38:317/333 of query aligns to 28:300/300 of 1v1bA
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
25% identity, 89% coverage: 23:318/333 of query aligns to 16:305/308 of 2dcnA
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
25% identity, 83% coverage: 42:318/333 of query aligns to 31:307/311 of 2varA
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 83% coverage: 42:318/333 of query aligns to 32:308/313 of Q97U29
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
25% identity, 92% coverage: 15:321/333 of query aligns to 5:299/299 of 1tz3A
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
25% identity, 92% coverage: 15:321/333 of query aligns to 9:310/319 of Q8ZKR2
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 79% coverage: 16:278/333 of query aligns to 6:256/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
27% identity, 79% coverage: 16:278/333 of query aligns to 5:255/302 of 3gbuA
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
25% identity, 92% coverage: 15:319/333 of query aligns to 5:297/297 of 1tz6A
8cqxA Ribokinase from t.Sp mutant a92g
26% identity, 92% coverage: 13:318/333 of query aligns to 2:298/300 of 8cqxA
6znxC Ribokinase from thermus species
25% identity, 92% coverage: 13:318/333 of query aligns to 2:263/265 of 6znxC
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
27% identity, 83% coverage: 43:319/333 of query aligns to 38:295/298 of 7agkA
Sites not aligning to the query:
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
27% identity, 83% coverage: 43:319/333 of query aligns to 38:295/302 of 7ag6A
Sites not aligning to the query:
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
27% identity, 83% coverage: 43:319/333 of query aligns to 38:295/298 of P32143
Sites not aligning to the query:
6a8cA Ribokinase from leishmania donovani with adp (see paper)
25% identity, 92% coverage: 12:316/333 of query aligns to 15:324/327 of 6a8cA
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
25% identity, 92% coverage: 12:316/333 of query aligns to 15:324/327 of 6a8bA
>3607860 FitnessBrowser__Dino:3607860
MMDVLEAIRSRNFLVIGRVGMDLSPAPAGTAIEDATDLMVAMGGSSANIAAGLVKFGARA
ALVTRVSDDAVGRYCLNQLAAYGVDATHVTPVAGEFRNSLALYESRLADHNSVIYRNGAA
DFQMSVADVEAVDYSQYGALITAGTVFAAEPSRSATFRAFELARAAGLPIIFDVDYRPYS
WPSPQVAEEVLSRAGALSDIIVANDEEFGFMAGGIDKGLAKARELAQTSAGIVVYKMGPE
GAITFANGTELRTGIYPVTALKPTGAGDSFMAGFLASLAEGRELREAVLRGSACAAIVVA
KPGCAPAMPDARELDAFLARHPGPRNAPQPAEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory