Comparing 3607863 FitnessBrowser__Dino:3607863 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
Q81RQ4 3-dehydroshikimate dehydratase; 3-DHS dehydratase; DHSase; Petrobactin biosynthesis protein AsbF; EC 4.2.1.118 from Bacillus anthracis (see paper)
30% identity, 47% coverage: 117:255/298 of query aligns to 105:241/280 of Q81RQ4
Sites not aligning to the query:
3dx5A Crystal structure of the probable 3-dhs dehydratase asbf involved in the petrobactin synthesis from bacillus anthracis (see paper)
27% identity, 57% coverage: 85:255/298 of query aligns to 79:241/274 of 3dx5A
Sites not aligning to the query:
>3607863 FitnessBrowser__Dino:3607863
MTIRIGNAPCSWGVEFAGDPRNPDWRQVLRETAAAGYTGIELGPIGFMPEDPPQVADALA
EHELELIGGVVFRPFHDRAAWEEVLDASVRTCKALVAHGAQHLVLIDSISPRRAPTAGRA
GAAEQMDAVEWAAFRDRIAHVARMGADEYGLTVGIHAHAAGFMDFEPELERLLDEVDDSI
LKICFDTGHHSYAGFDPVAFMQRHLPRISYMHFKDIDPAVKANVIARGTGFYDACGQGIF
CNLGEGDVNFPRVRQLLIDHGFDGWCTVEQDCDPTLPDTDPFGDAMTNRAYLRAIGFE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory