Comparing 3607866 FitnessBrowser__Dino:3607866 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
4ru1A Crystal structure of carbohydrate transporter acei_1806 from acidothermus cellulolyticus 11b, target efi-510965, in complex with myo-inositol
33% identity, 87% coverage: 39:321/325 of query aligns to 5:283/288 of 4ru1A
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
24% identity, 82% coverage: 53:317/325 of query aligns to 14:284/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
24% identity, 82% coverage: 53:317/325 of query aligns to 14:284/313 of 2h3hA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
27% identity, 79% coverage: 35:290/325 of query aligns to 3:258/283 of 6gt9A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
28% identity, 77% coverage: 40:290/325 of query aligns to 3:253/278 of 6guqA
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
23% identity, 85% coverage: 41:316/325 of query aligns to 10:284/287 of 7x0hA
5xssA Xylfii molecule (see paper)
21% identity, 76% coverage: 42:288/325 of query aligns to 7:253/274 of 5xssA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
23% identity, 72% coverage: 53:285/325 of query aligns to 19:255/289 of 5hqjA
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
24% identity, 73% coverage: 43:278/325 of query aligns to 5:245/290 of 4wutA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
23% identity, 80% coverage: 50:308/325 of query aligns to 17:283/303 of 5dkvA
>3607866 FitnessBrowser__Dino:3607866
MRADIVWEDDMKTILKSVALGAALVAAPFASFAQSDDDLNYVLVSHAPDSDTWWNTIKNG
IALAGEQMGVSVEYRNPPTGDIADMARIIEQAAASAPDGIITTLADFDVLQGPIKNAVDQ
GIDVIIMNTGTPEQAREIGALMYVGQPEYDAGFAAGQRAKGEGVTKFLCVNHAIQQPTVG
ERCRGYADGLGIELGDAMMDSGTDPAEIKNKVMAYLSTNEDVDGILTLGPVSADPTIAAL
NEMGLAGEIHFGTFDLGEEIVKAIKDGTINWGIDQQPFLQAYMPVVILANWDRYGVLPGN
NINSGPGFVTASGLEKVEAFAGEYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory