Comparing 3607868 FitnessBrowser__Dino:3607868 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 91% coverage: 10:249/264 of query aligns to 4:239/501 of P04983
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 95% coverage: 11:261/264 of query aligns to 7:242/353 of 1vciA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 87% coverage: 9:238/264 of query aligns to 1:223/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 87% coverage: 11:240/264 of query aligns to 7:234/375 of 2d62A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 89% coverage: 10:243/264 of query aligns to 1:223/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 89% coverage: 10:245/264 of query aligns to 3:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 89% coverage: 10:245/264 of query aligns to 3:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 89% coverage: 10:245/264 of query aligns to 3:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 89% coverage: 10:245/264 of query aligns to 3:227/242 of 2oljA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 89% coverage: 10:243/264 of query aligns to 6:231/240 of 1ji0A
1g291 Malk (see paper)
31% identity, 89% coverage: 11:245/264 of query aligns to 4:229/372 of 1g291
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 87% coverage: 10:238/264 of query aligns to 1:215/348 of 3d31A
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 91% coverage: 10:248/264 of query aligns to 4:243/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 91% coverage: 10:248/264 of query aligns to 4:243/254 of 1g6hA
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
29% identity, 83% coverage: 11:229/264 of query aligns to 3:211/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
29% identity, 83% coverage: 11:229/264 of query aligns to 1:209/367 of 1q12A
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
29% identity, 83% coverage: 11:229/264 of query aligns to 3:211/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
29% identity, 83% coverage: 11:229/264 of query aligns to 3:211/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
29% identity, 83% coverage: 11:229/264 of query aligns to 3:211/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
29% identity, 83% coverage: 11:229/264 of query aligns to 3:211/371 of 3puvA
>3607868 FitnessBrowser__Dino:3607868
MDSRTNRAPIIQMKNIEKHFGAVIALAGVSIDIFPGECHCLLGDNGAGKSTFIKTMSGVH
KPTKGEIIFEGRPMHFEDPRDAMEAGIATVHQHLAMIPLMSVSRNFFMGNEPVKKIAGIN
FLDREFADRVTMEEMRKMGINLRGPDQAVGTLSGGERQTVAISRAVYFGAKVLILDEPTS
ALGVRQTSNVLATIDKVRKQGVAVVFITHNVRHAMAVGDRFTVLNRGQTLGTAERGEITP
EELQDMMAGGQELATLEGSLGGTV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory