SitesBLAST
Comparing 3607873 FitnessBrowser__Dino:3607873 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vw6B Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
60% identity, 96% coverage: 19:563/565 of query aligns to 10:556/560 of 7vw6B
- binding fe2/s2 (inorganic) cluster: C108 (= C113), T112 (≠ S117), C113 (= C118), C141 (= C146), L144 (≠ R149), C145 (= C150)
- binding flavin mononucleotide: G221 (= G225), G223 (= G227), K232 (= K236), N248 (= N252), D250 (= D254), Y324 (= Y332), G327 (= G335), E328 (= E336), N363 (≠ H371), N364 (= N372), T367 (= T375)
- binding iron/sulfur cluster: I325 (= I333), P343 (= P351), S496 (= S503), C497 (= C504), G498 (= G505), Q499 (= Q506), C500 (= C507), C503 (= C510), I536 (= I543), C537 (= C544), L539 (= L546), G540 (= G547)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
35% identity, 81% coverage: 109:564/565 of query aligns to 27:554/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C31 (= C113), G33 (≠ S115), C36 (= C118), C82 (= C146), F85 (≠ R149), C86 (= C150)
- binding flavin mononucleotide: G201 (= G227), N227 (= N252), E230 (= E255), N355 (= N372), G535 (= G545), L536 (= L546)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E337), R337 (= R354), R340 (≠ Y357), T341 (≠ V358), N342 (≠ A359), S433 (= S449)
- binding iron/sulfur cluster: S487 (= S503), C488 (= C504), G489 (= G505), C491 (= C507), C494 (= C510), C534 (= C544), L536 (= L546), G537 (= G547)
- binding zinc ion: C471 (≠ R487)
Sites not aligning to the query:
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
37% identity, 81% coverage: 108:564/565 of query aligns to 26:540/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (= C113), G33 (≠ S115), T34 (≠ L116), C36 (= C118), C67 (= C146), C68 (≠ M147), G69 (= G148), R70 (= R149), C71 (= C150)
- binding flavin mononucleotide: G185 (= G225), R186 (≠ L226), G187 (= G227), N213 (= N252), D215 (= D254), E216 (= E255), G217 (= G256), F301 (≠ Y332), G304 (= G335), E305 (= E336), E306 (= E337), N340 (≠ H371), N341 (= N372), G521 (= G545), L522 (= L546)
- binding iron/sulfur cluster: P320 (= P351), S473 (= S503), C474 (= C504), G475 (= G505), K476 (≠ Q506), C477 (= C507), C480 (= C510), L519 (≠ I543), C520 (= C544), L522 (= L546), G523 (= G547)
- binding zinc ion: C457 (≠ R487)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
42% identity, 67% coverage: 185:564/565 of query aligns to 25:412/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G225), G66 (= G227), K75 (= K236), N91 (= N252), D93 (= D254), E94 (= E255), G182 (= G335), E183 (= E336), E184 (= E337), V217 (= V370), N218 (≠ H371), N219 (= N372), T222 (= T375), G393 (= G545)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G227), G67 (= G228), A68 (= A229), F70 (= F231), K75 (= K236), E94 (= E255), E96 (= E257), Y179 (= Y332), E184 (= E337), Y204 (= Y357)
- binding iron/sulfur cluster: P198 (= P351), T345 (≠ S503), C346 (= C504), G347 (= G505), Q348 (= Q506), C349 (= C507), C352 (= C510), I391 (= I543), C392 (= C544), L394 (= L546), G395 (= G547)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
42% identity, 67% coverage: 185:564/565 of query aligns to 25:412/419 of 6saqB
- binding flavin mononucleotide: G64 (= G225), G66 (= G227), K75 (= K236), N91 (= N252), D93 (= D254), E94 (= E255), Y179 (= Y332), G182 (= G335), E183 (= E336), N218 (≠ H371), N219 (= N372), T222 (= T375)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G227), G67 (= G228), A68 (= A229), F70 (= F231), K75 (= K236), E94 (= E255), E96 (= E257), T99 (= T260), E184 (= E337), Y204 (= Y357), T318 (≠ S476)
- binding iron/sulfur cluster: P198 (= P351), T345 (≠ S503), C346 (= C504), G347 (= G505), Q348 (= Q506), C349 (= C507), C352 (= C510), I391 (= I543), C392 (= C544), G395 (= G547)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
42% identity, 67% coverage: 185:564/565 of query aligns to 26:413/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G225), G67 (= G227), K76 (= K236), N92 (= N252), E95 (= E255), Y180 (= Y332), G183 (= G335), E184 (= E336), V218 (= V370), N219 (≠ H371), N220 (= N372), T223 (= T375)
- binding iron/sulfur cluster: T346 (≠ S503), C347 (= C504), G348 (= G505), Q349 (= Q506), C350 (= C507), C353 (= C510), S391 (= S542), I392 (= I543), C393 (= C544), G396 (= G547)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
42% identity, 67% coverage: 185:564/565 of query aligns to 24:411/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G225), G65 (= G227), K74 (= K236), N90 (= N252), D92 (= D254), E93 (= E255), G181 (= G335), E182 (= E336), E183 (= E337), V216 (= V370), N217 (≠ H371), N218 (= N372), T221 (= T375)
- binding nicotinamide-adenine-dinucleotide: G65 (= G227), G66 (= G228), A67 (= A229), F69 (= F231), K74 (= K236), E95 (= E257), Y178 (= Y332), E183 (= E337), K200 (≠ R354), Y203 (= Y357)
- binding iron/sulfur cluster: I179 (= I333), P197 (= P351), T344 (≠ S503), C345 (= C504), G346 (= G505), Q347 (= Q506), C348 (= C507), C351 (= C510), S389 (= S542), I390 (= I543), C391 (= C544), L393 (= L546), G394 (= G547)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
35% identity, 81% coverage: 110:564/565 of query aligns to 8:523/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C11 (= C113), C16 (= C118), C48 (= C146), F49 (≠ M147), L51 (≠ R149), C52 (= C150)
- binding flavin mononucleotide: G166 (= G225), G168 (= G227), N196 (= N252), D198 (= D254), F284 (≠ Y332), G287 (= G335), E288 (= E336), E289 (= E337), N324 (= N372)
- binding iron/sulfur cluster: C457 (= C504), G458 (= G505), K459 (≠ Q506), C460 (= C507), C463 (= C510), C503 (= C544), G506 (= G547)
- binding zinc ion: C440 (≠ R487)
Sites not aligning to the query:
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
41% identity, 62% coverage: 214:564/565 of query aligns to 3:371/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G225), G16 (= G227), N44 (= N252), G135 (= G335), E137 (= E337), N171 (≠ H371), N172 (= N372), G352 (= G545)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G227), G17 (= G228), F20 (= F231), K25 (= K236), F28 (= F239), D49 (≠ E257), R154 (= R354), F157 (≠ Y357), S250 (= S449)
- binding iron/sulfur cluster: P151 (= P351), C305 (= C504), G306 (= G505), K307 (≠ Q506), C308 (= C507), C311 (= C510), C351 (= C544), G354 (= G547)
- binding zinc ion: C288 (≠ R487)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
41% identity, 62% coverage: 214:564/565 of query aligns to 26:394/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G225), G39 (= G227), N67 (= N252), G158 (= G335), E159 (= E336), E160 (= E337), G375 (= G545)
- binding nicotinamide-adenine-dinucleotide: G40 (= G228), F43 (= F231), K48 (= K236), R177 (= R354), F180 (≠ Y357), M297 (≠ F473)
- binding iron/sulfur cluster: S327 (= S503), C328 (= C504), G329 (= G505), K330 (≠ Q506), C331 (= C507), C334 (= C510), L373 (≠ I543), C374 (= C544)
- binding zinc ion: C311 (≠ R487)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
41% identity, 67% coverage: 186:564/565 of query aligns to 15:409/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ R487), C364 (vs. gap)
- binding flavin mononucleotide: G54 (= G225), G56 (= G227), K65 (= K236), N82 (= N252), D84 (= D254), E85 (= E255), G173 (= G335), E175 (= E337), N210 (= N372), G390 (= G545), L391 (= L546)
- binding nicotinamide-adenine-dinucleotide: G56 (= G227), G57 (= G228), A58 (= A229), F60 (= F231), K65 (= K236), F68 (= F239), E85 (= E255), E175 (= E337), R192 (= R354), F195 (≠ Y357), I312 (≠ F473), M313 (≠ I474), S315 (= S476)
- binding iron/sulfur cluster: S342 (= S503), C343 (= C504), G344 (= G505), C346 (= C507), C349 (= C510), S387 (= S542), C389 (= C544), L391 (= L546), G392 (= G547)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
41% identity, 67% coverage: 186:564/565 of query aligns to 15:409/425 of 7t2rB
Sites not aligning to the query:
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
40% identity, 67% coverage: 190:565/565 of query aligns to 26:419/442 of 7p61F
- binding flavin mononucleotide: G61 (= G225), G63 (= G227), K72 (= K236), N90 (= N252), D92 (= D254), G181 (= G335), E182 (= E336), N217 (≠ H371), N218 (= N372), A399 (≠ G545), H400 (≠ L546)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G227), G64 (= G228), A65 (= A229), F67 (= F231), K72 (= K236), L75 (≠ F239), E95 (= E257), Y178 (= Y332), E183 (= E337), F203 (≠ Y357), R320 (≠ F473), T323 (≠ S476)
- binding iron/sulfur cluster: S350 (= S503), C351 (= C504), W353 (≠ Q506), C354 (= C507), C357 (= C510), F397 (≠ I543), C398 (= C544), H400 (≠ L546)
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
39% identity, 67% coverage: 189:564/565 of query aligns to 27:419/437 of 4hea1
- binding flavin mononucleotide: G63 (= G225), K74 (= K236), N91 (= N252), D93 (= D254), Y179 (= Y332), G182 (= G335), E183 (= E336), N218 (≠ H371), N219 (= N372), L401 (= L546)
- binding iron/sulfur cluster: I180 (= I333), P198 (= P351), S351 (= S503), C352 (= C504), G353 (= G505), K354 (≠ Q506), C355 (= C507), C358 (= C510), F398 (≠ I543), C399 (= C544), L401 (= L546)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
39% identity, 67% coverage: 189:564/565 of query aligns to 27:419/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G225), G65 (= G227), N91 (= N252), D93 (= D254), G182 (= G335), E183 (= E336), E184 (= E337), N218 (≠ H371), N219 (= N372), T222 (= T375), P400 (≠ G545)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G227), G66 (= G228), F69 (= F231), K74 (= K236), F77 (= F239), E96 (= E257), Y179 (= Y332), E184 (= E337), K201 (≠ R354), F204 (≠ Y357), T324 (≠ S476)
- binding iron/sulfur cluster: S351 (= S503), C352 (= C504), K354 (≠ Q506), C355 (= C507), C358 (= C510), F398 (≠ I543), C399 (= C544), L401 (= L546), A402 (≠ G547)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
39% identity, 67% coverage: 189:564/565 of query aligns to 28:420/438 of Q56222
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
33% identity, 76% coverage: 138:564/565 of query aligns to 33:508/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C41 (= C146), C45 (= C150)
- binding flavin mononucleotide: R154 (≠ L226), K164 (= K236), N181 (= N252), F269 (≠ Y332), E273 (= E336), E274 (= E337), I307 (≠ V370), N308 (≠ H371), N309 (= N372), G489 (= G545), L490 (= L546)
- binding nicotinamide-adenine-dinucleotide: G155 (= G227), G156 (= G228), F159 (= F231), F163 (≠ T235), E273 (= E336), E274 (= E337), K291 (≠ R354), F294 (≠ Y357), G413 (= G475)
- binding iron/sulfur cluster: P288 (= P351), C442 (= C504), G443 (= G505), C445 (= C507), C448 (= C510), C488 (= C544), L490 (= L546), G491 (= G547)
- binding zinc ion: C425 (≠ R487)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
37% identity, 73% coverage: 153:564/565 of query aligns to 80:509/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G225), G156 (= G227), K165 (= K236), N182 (= N252), E185 (= E255), G273 (= G335), E274 (= E336), E275 (= E337), N309 (≠ H371), N310 (= N372), S313 (≠ T375), A490 (≠ G545), M491 (≠ L546)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (= A229), F160 (= F231), K165 (= K236), T168 (≠ F239), E275 (= E337), L295 (≠ Y357)
- binding iron/sulfur cluster: V271 (≠ I333), V289 (≠ P351), S442 (= S503), C443 (= C504), G444 (= G505), K445 (≠ Q506), C446 (= C507), C449 (= C510), L488 (≠ I543), C489 (= C544), M491 (≠ L546), G492 (= G547)
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
38% identity, 67% coverage: 190:565/565 of query aligns to 23:419/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G225), G59 (= G227), K68 (= K236), N89 (= N252), D91 (= D254), E92 (= E255), G180 (= G335), E181 (= E336), E182 (= E337), T216 (≠ H371), N217 (= N372)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G227), G60 (= G228), F63 (= F231), K68 (= K236), E94 (= E257), Y177 (= Y332), E182 (= E337), F202 (≠ Y357), T324 (≠ S476)
- binding iron/sulfur cluster: P196 (= P351), S351 (= S503), C352 (= C504), G353 (= G505), Q354 (= Q506), C355 (= C507), C358 (= C510), T396 (≠ S542), C398 (= C544), L400 (= L546)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
38% identity, 67% coverage: 190:565/565 of query aligns to 24:420/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G227), K69 (= K236), N90 (= N252), D92 (= D254), E93 (= E255), G94 (= G256), Y178 (= Y332), G181 (= G335), E182 (= E336), N218 (= N372)
- binding iron/sulfur cluster: P197 (= P351), S352 (= S503), C353 (= C504), Q355 (= Q506), C356 (= C507), C359 (= C510), T397 (≠ S542), C399 (= C544)
Query Sequence
>3607873 FitnessBrowser__Dino:3607873
MALDRKSATKTGVWTSGAGRGRKTPKGRQVTDQAWAELREVLGDRPRRRDLLIEFLHLIQ
DRYGHLSAAHLRALAEEMRLSQAEVYEVASFYAHFDVVKEGESPPPALTIRVCDSLSCEL
AGAQALKSALEDGLDPGQVRVLRAPCMGRCATAPVLELGHNHIDHATPEKVQQAIAANHT
HPTIPDYETLAAYRAEGGYGVLRDLRASGDWEVVQAQVKQSGLRGLGGAGFPSGTKWGFV
RANPGPRYLAVNGDEGEPGTFKDRHYLERVPHLFLEGMLIAAWAVEAERCYIYMRDEYPA
VLEILRREIAALEEAGIAEPGHIELRRGAGAYICGEESAMIESIEGKRGMPRHRPPYVAQ
VGLFGRPTLVHNVETLHWIARICREGPEVLSATTHNDRVGLRSYSVSGRVARPGVYLLPA
GSTILDIIDAAGGMAEGHVFKAFQPGGPSSGLLPASAADVPLDFDTLQPLGTFIGSAAVV
VLSDQDRARDAALNMLRFFEDESCGQCTPCRVGCEKAVKLMQAERWDAGLLSELCTAMAD
ASICGLGQAAPNPILSTIKHFPEEV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory