SitesBLAST
Comparing 3607874 FitnessBrowser__Dino:3607874 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vw6A Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
66% identity, 98% coverage: 9:921/933 of query aligns to 1:910/913 of 7vw6A
- binding fe2/s2 (inorganic) cluster: H32 (= H40), C34 (= C42), H35 (= H43), G45 (= G53), C47 (= C55), R48 (= R56), C50 (= C58), C64 (= C72)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K263 (= K275), K339 (= K350), C364 (= C375), C368 (= C379), G402 (= G413), N404 (= N415), N408 (= N419), D431 (= D441), P432 (= P442), R433 (= R443), F447 (= F457), G450 (= G460), D452 (= D462), G525 (= G535), M526 (= M536), G527 (= G537), Q530 (= Q540), H531 (= H541), G563 (= G573), Q564 (= Q574), G630 (= G641), N632 (= N643), S636 (= S647), Q656 (= Q667), D657 (= D668), L658 (≠ I669), T805 (= T816), R807 (= R818), R807 (= R818), V808 (≠ Q819), L809 (= L820), H811 (= H822), W812 (= W823), H813 (= H824), H813 (= H824), T814 (= T825), M817 (= M828), F879 (= F890), N887 (= N898), F903 (= F914), K904 (= K915)
- binding iron/sulfur cluster: C145 (= C156), I146 (= I157), Q147 (= Q158), C148 (= C159), N149 (≠ G160), C151 (= C162), C155 (= C166), N161 (= N172), V163 (= V174), I164 (= I175), V175 (≠ P186), C188 (= C199), V189 (= V200), A190 (= A201), C191 (= C202), G192 (= G203), C194 (= C205), C198 (= C209), P199 (= P210), T200 (= T211), A202 (= A213), L203 (= L214), C227 (= C239), C230 (= C242), C234 (= C246), C261 (= C273), K263 (= K275), G264 (= G276), V411 (= V422)
6tg9A Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
36% identity, 98% coverage: 10:921/933 of query aligns to 19:925/949 of 6tg9A
- active site: K289 (= K275), C380 (= C379), H381 (= H380), L545 (≠ M536), G582 (= G573), Q583 (= Q574)
- binding fe2/s2 (inorganic) cluster: C51 (= C42), V59 (≠ D52), G60 (= G53), C62 (= C55), C65 (= C58), C79 (= C72)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C255 (= C242), K289 (= K275), R351 (≠ K350), C352 (= C351), C380 (= C379), G414 (= G413), A415 (= A414), D419 (≠ E418), G420 (≠ N419), H421 (= H420), P443 (= P442), R444 (= R443), P464 (= P459), N467 (≠ D462), L545 (≠ M536), G546 (= G537), H550 (= H541), G582 (= G573), Q583 (= Q574), Q583 (= Q574), G649 (= G641), E650 (= E642), S655 (= S647), N680 (≠ T672), S693 (= S685), K698 (= K690), D724 (= D717), T820 (= T815), T821 (= T816), R823 (= R818), R823 (= R818), I824 (≠ Q819), L825 (= L820), N829 (≠ H824), V830 (≠ T825), Q833 (≠ M828), N902 (= N898), Y918 (≠ F914), K919 (= K915)
- binding iron/sulfur cluster: H111 (≠ Q104), C115 (≠ A106), C118 (≠ E109), A120 (≠ H111), C124 (≠ A115), C176 (= C156), I177 (= I157), V178 (≠ Q158), C179 (= C159), M180 (≠ G160), C182 (= C162), C186 (= C166), I206 (≠ P186), C218 (= C199), S220 (≠ A201), C221 (= C202), G222 (= G203), C224 (= C205), C228 (= C209), T230 (= T211), A231 (≠ G212), C252 (= C239), Y254 (≠ F241), C255 (= C242), V257 (= V244), C259 (= C246), F261 (≠ V248), C287 (= C273), K289 (= K275), V423 (= V422)
1fdiA Oxidized form of formate dehydrogenase h from e. Coli complexed with the inhibitor nitrite (see paper)
35% identity, 75% coverage: 234:933/933 of query aligns to 3:696/715 of 1fdiA
- active site: C11 (= C242), L41 (= L272), C42 (= C273), K44 (= K275), S108 (= S348), R110 (≠ K350), D134 (= D373), C140 (= C379), H141 (= H380), S180 (≠ N419), M297 (= M536), R333 (= R572), G334 (= G573), Q335 (= Q574)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K275), R110 (≠ K350), G111 (≠ C351), V139 (≠ L378), C140 (= C379), F173 (≠ I412), G174 (= G413), Y175 (≠ A414), N176 (= N415), D179 (≠ E418), S180 (≠ N419), C201 (≠ L440), D202 (= D441), P203 (= P442), R204 (= R443), L218 (≠ F457), G221 (= G460), N223 (≠ D462), G296 (= G535), M297 (= M536), G298 (= G537), F302 (≠ H541), G334 (= G573), Q335 (= Q574), Q335 (= Q574), G402 (= G641), E403 (= E642), T408 (≠ S647), Q428 (= Q667), D429 (= D668), I430 (= I669), S445 (≠ A684), D478 (= D717), T579 (= T816), V580 (≠ G817), R581 (= R818), R581 (= R818), E582 (≠ Q819), H585 (= H822), Y586 (≠ W823), S587 (≠ H824), C588 (≠ T825), Y654 (≠ F890), N662 (= N898), Y678 (≠ F914), K679 (= K915)
- binding nitrite ion: C140 (= C379), H141 (= H380), R333 (= R572), G334 (= G573), V338 (= V577)
- binding iron/sulfur cluster: C8 (= C239), Y10 (≠ F241), C11 (= C242), S13 (≠ V244), C15 (= C246), L41 (= L272), C42 (= C273), K44 (= K275), P182 (= P421), I183 (≠ V422)
P07658 Formate dehydrogenase H; Formate dehydrogenase-H subunit alpha; FDH-H; Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide; EC 1.17.98.4 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 75% coverage: 234:933/933 of query aligns to 3:696/715 of P07658
- C8 (= C239) binding
- Y10 (≠ F241) binding
- C11 (= C242) binding
- C15 (= C246) binding
- C42 (= C273) binding
- K44 (= K275) binding
- U140 (≠ C379) modified: nonstandard, Selenocysteine
- M297 (= M536) binding
- Q301 (= Q540) binding
- Q335 (= Q574) binding
- S445 (≠ A684) binding
- D478 (= D717) binding
- C588 (≠ T825) binding
- Y654 (≠ F890) binding
- Q655 (≠ A891) binding
- Y678 (≠ F914) binding
- K679 (= K915) binding
2iv2X Reinterpretation of reduced form of formate dehydrogenase h from e. Coli (see paper)
35% identity, 75% coverage: 234:933/933 of query aligns to 3:678/697 of 2iv2X
- active site: C11 (= C242), L41 (= L272), C42 (= C273), K44 (= K275), S108 (= S348), C140 (= C379), H141 (= H380), S180 (≠ N419), M297 (= M536), R333 (= R572), G334 (= G573), Q335 (= Q574)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: R110 (≠ K350), G111 (≠ C351), T112 (= T352), A137 (≠ T376), Q335 (= Q574), G402 (= G641), E403 (= E642), D404 (≠ N643), T408 (≠ S647), A410 (≠ P649), Q428 (= Q667), D429 (= D668), I430 (= I669), S445 (≠ A684), D478 (= D717), C588 (≠ T825), Y660 (≠ F914)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K275), F173 (≠ I412), G174 (= G413), Y175 (≠ A414), N176 (= N415), D179 (≠ E418), S180 (≠ N419), D202 (= D441), P203 (= P442), R204 (= R443), N223 (≠ D462), G296 (= G535), M297 (= M536), F302 (≠ H541), G334 (= G573), R581 (= R818), E582 (≠ Q819), V583 (≠ L820), H585 (= H822), Y586 (≠ W823), S587 (≠ H824), K661 (= K915)
- binding iron/sulfur cluster: C8 (= C239), C11 (= C242), S13 (≠ V244), C15 (= C246), L41 (= L272), C42 (= C273), K44 (= K275), G45 (= G276), I183 (≠ V422)
7qv7S Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
41% identity, 63% coverage: 233:817/933 of query aligns to 2:571/571 of 7qv7S
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
37% identity, 61% coverage: 235:802/933 of query aligns to 7:549/549 of 7bkbD
2jiqA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
31% identity, 74% coverage: 235:921/933 of query aligns to 6:717/720 of 2jiqA
- active site: K46 (= K275), S106 (= S348), C137 (= C379), M138 (≠ H380), A177 (≠ N419), M305 (= M536), T341 (≠ R572), G342 (= G573), Q343 (= Q574)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ P240), Q108 (≠ K350), C137 (= C379), G171 (= G413), S172 (≠ A414), E176 (= E418), A177 (≠ N419), D201 (= D441), P202 (= P442), R203 (= R443), P219 (= P459), D222 (= D462), C304 (≠ G535), M305 (= M536), G306 (= G537), Q309 (= Q540), R310 (≠ H541), G342 (= G573), Q343 (= Q574), Q343 (= Q574), E413 (≠ G641), T414 (≠ E642), N415 (= N643), T419 (≠ S647), I440 (vs. gap), E441 (≠ Q667), F443 (≠ I669), P458 (≠ A684), F460 (≠ A686), S612 (≠ T816), M613 (≠ G817), R614 (= R818), R614 (= R818), I616 (≠ L820), H618 (= H822), W619 (= W823), H620 (= H824), H620 (= H824), T621 (= T825), T623 (≠ S827), F686 (= F890), N694 (= N898), Y710 (≠ F914), K711 (= K915)
- binding nitrate ion: M251 (vs. gap), K583 (≠ R787), V589 (≠ M793), W591 (≠ T795), R593 (≠ A797), V704 (≠ Y908)
- binding iron/sulfur cluster: C10 (= C239), C13 (= C242), T15 (≠ V244), C17 (= C246), L43 (= L272), C44 (= C273), V180 (= V422)
2v45A A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
31% identity, 74% coverage: 235:921/933 of query aligns to 9:720/723 of 2v45A
- active site: K49 (= K275), S109 (= S348), C140 (= C379), M141 (≠ H380), A180 (≠ N419), M308 (= M536), T344 (≠ R572), G345 (= G573), Q346 (= Q574)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R14 (≠ P240), K49 (= K275), Q111 (≠ K350), C140 (= C379), G174 (= G413), N176 (= N415), E179 (= E418), A180 (≠ N419), D204 (= D441), P205 (= P442), R206 (= R443), P222 (= P459), D225 (= D462), C307 (≠ G535), M308 (= M536), G309 (= G537), Q312 (= Q540), R313 (≠ H541), G345 (= G573), Q346 (= Q574), Q346 (= Q574), E416 (≠ G641), T417 (≠ E642), N418 (= N643), T422 (≠ S647), I443 (vs. gap), E444 (≠ Q667), A445 (≠ D668), F446 (≠ I669), P461 (≠ A684), F463 (≠ A686), S615 (≠ T816), M616 (≠ G817), R617 (= R818), R617 (= R818), V618 (≠ Q819), I619 (≠ L820), H621 (= H822), W622 (= W823), H623 (= H824), H623 (= H824), T624 (= T825), T626 (≠ S827), F689 (= F890), N697 (= N898), Y713 (≠ F914), K714 (= K915)
- binding iron/sulfur cluster: C13 (= C239), C16 (= C242), T18 (≠ V244), C20 (= C246), L46 (= L272), C47 (= C273), V183 (= V422)
P81186 Periplasmic nitrate reductase; EC 1.9.6.1 from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) (see 3 papers)
31% identity, 74% coverage: 235:921/933 of query aligns to 41:752/755 of P81186
Sites not aligning to the query:
- 1:32 signal peptide, Tat-type signal
2jirA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
31% identity, 74% coverage: 235:921/933 of query aligns to 6:717/720 of 2jirA
- active site: K46 (= K275), S106 (= S348), C137 (= C379), M138 (≠ H380), A177 (≠ N419), M305 (= M536), T341 (≠ R572), G342 (= G573), Q343 (= Q574)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ P240), K46 (= K275), Q108 (≠ K350), C137 (= C379), G171 (= G413), S172 (≠ A414), N173 (= N415), E176 (= E418), A177 (≠ N419), D201 (= D441), P202 (= P442), R203 (= R443), F217 (= F457), D222 (= D462), C304 (≠ G535), M305 (= M536), G306 (= G537), Q309 (= Q540), R310 (≠ H541), G342 (= G573), Q343 (= Q574), Q343 (= Q574), E413 (≠ G641), T414 (≠ E642), N415 (= N643), T419 (≠ S647), I440 (vs. gap), E441 (≠ Q667), A442 (≠ D668), P458 (≠ A684), F460 (≠ A686), S612 (≠ T816), M613 (≠ G817), R614 (= R818), R614 (= R818), I616 (≠ L820), H618 (= H822), W619 (= W823), H620 (= H824), H620 (= H824), T621 (= T825), T623 (≠ S827), F686 (= F890), N694 (= N898), Y710 (≠ F914), K711 (= K915)
- binding nitrite ion: V615 (≠ Q819), F686 (= F890)
- binding iron/sulfur cluster: C10 (= C239), C13 (= C242), T15 (≠ V244), C17 (= C246), L43 (= L272), C44 (= C273), P179 (= P421), V180 (= V422)
1h0hA Tungsten containing formate dehydrogenase from desulfovibrio gigas (see paper)
25% identity, 53% coverage: 234:728/933 of query aligns to 12:616/977 of 1h0hA
- active site: K56 (= K275), C158 (= C379), H159 (= H380), M371 (= M536), R407 (= R572), G408 (= G573), E409 (≠ Q574)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: A130 (≠ K350), Q154 (≠ C375), I157 (≠ L378), C158 (= C379), M371 (= M536), G516 (= G641), Q517 (≠ E642), N518 (= N643), S522 (= S647), N543 (≠ D668), I544 (= I669), C572 (≠ A684), D605 (= D717)
- binding calcium ion: T358 (≠ A527), K360 (vs. gap), K363 (≠ R528), L393 (≠ C558), G394 (= G559), N395 (≠ H560)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K56 (= K275), C158 (= C379), S193 (≠ A414), N194 (= N415), N198 (= N419), D220 (= D441), P221 (= P442), R222 (= R443), S238 (≠ P459), G239 (= G460), D241 (= D462), A370 (≠ G535), M371 (= M536), W373 (≠ V538), G408 (= G573)
- binding iron/sulfur cluster: C17 (= C239), Y19 (≠ F241), C20 (= C242), V22 (= V244), C24 (= C246), L53 (= L272), C54 (= C273), K56 (= K275), G57 (= G276), P200 (= P421), I201 (≠ V422)
Sites not aligning to the query:
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: 854, 856, 862, 863, 866, 936, 951, 967
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 855, 856, 858, 860, 861, 862, 968
Q934F5 Formate dehydrogenase subunit alpha; FDH subunit alpha; Formate dehydrogenase large subunit; EC 1.17.1.9 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
25% identity, 53% coverage: 234:728/933 of query aligns to 47:651/1012 of Q934F5
- C52 (= C239) binding
- C55 (= C242) binding
- C59 (= C246) binding
- C89 (= C273) binding
- U193 (≠ C379) binding ; modified: nonstandard, Selenocysteine
Sites not aligning to the query:
- 852 modified: Disulfide link with 879
- 879 modified: Disulfide link with 852
8cm5A W-formate dehydrogenase c872a from desulfovibrio vulgaris (see paper)
25% identity, 53% coverage: 234:728/933 of query aligns to 10:617/974 of 8cm5A
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K55 (= K275), A129 (≠ K350), Q153 (≠ C375), I156 (≠ L378), C157 (= C379), G191 (= G413), S192 (≠ A414), N193 (= N415), N197 (= N419), D219 (= D441), P220 (= P442), R221 (= R443), S237 (≠ P459), D240 (= D462), A369 (≠ G535), M370 (= M536), G371 (= G537), Q374 (= Q540), H375 (= H541), G407 (= G573), E408 (≠ Q574), E408 (≠ Q574), G517 (= G641), M518 (≠ E642), N519 (= N643), G523 (≠ S647), N544 (≠ D668), L545 (≠ I669), C573 (≠ A684), D606 (= D717)
- binding iron/sulfur cluster: C15 (= C239), C18 (= C242), C22 (= C246), L52 (= L272), C53 (= C273), I200 (≠ V422)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 846, 847, 848, 849, 849, 850, 851, 853, 854, 855, 855, 856, 858, 859, 929, 944, 960, 961
8cm6C W-formate dehydrogenase c872a from desulfovibrio vulgaris - with formamide (see paper)
25% identity, 53% coverage: 234:728/933 of query aligns to 10:617/971 of 8cm6C
- binding formamide: V231 (≠ H453), Y232 (≠ M454), R406 (= R572), T415 (≠ S581)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K55 (= K275), A129 (≠ K350), Q153 (≠ C375), I156 (≠ L378), C157 (= C379), G191 (= G413), S192 (≠ A414), N193 (= N415), N197 (= N419), D219 (= D441), P220 (= P442), R221 (= R443), S237 (≠ P459), D240 (= D462), A369 (≠ G535), M370 (= M536), G371 (= G537), Q374 (= Q540), H375 (= H541), G407 (= G573), G517 (= G641), M518 (≠ E642), N519 (= N643), G523 (≠ S647), N544 (≠ D668), C573 (≠ A684), K579 (= K690), D606 (= D717)
- binding iron/sulfur cluster: C15 (= C239), C18 (= C242), V20 (= V244), C22 (= C246), L52 (= L272), C53 (= C273), P199 (= P421), I200 (≠ V422)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 846, 847, 848, 849, 849, 850, 851, 853, 854, 855, 855, 856, 858, 859, 929, 944, 960, 961
Q53176 Periplasmic nitrate reductase; EC 1.9.6.1 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
29% identity, 53% coverage: 239:731/933 of query aligns to 48:575/831 of Q53176
- C48 (= C239) binding
- C51 (= C242) binding
- C55 (= C246) binding
- C83 (= C273) binding
- K85 (= K275) binding
- Q152 (≠ K350) binding
- N177 (≠ C375) binding
- C181 (= C379) binding
- 214:221 (vs. 412:419, 38% identical) binding
- GTD 264:266 (= GTD 460:462) binding
- M375 (= M536) binding
- Q379 (= Q540) binding
- N485 (= N643) binding
- SD 511:512 (≠ QD 667:668) binding
- K534 (= K690) binding
- D561 (= D717) binding
Sites not aligning to the query:
- 721:730 binding
- 805 binding
- 822 binding
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
26% identity, 72% coverage: 144:819/933 of query aligns to 601:1170/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C156), V614 (≠ I157), L615 (≠ Q158), C616 (= C159), G617 (= G160), C619 (= C162), C623 (= C166), I643 (≠ P186), C656 (= C199), I657 (≠ V200), S658 (≠ A201), C659 (= C202), G660 (= G203), C662 (= C205), C666 (= C209), G669 (= G212), A670 (= A213), C692 (= C239), Y694 (≠ F241), C695 (= C242), C699 (= C246), C725 (= C273), R727 (≠ K275), G728 (= G276), V853 (= V422)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573
P39185 Periplasmic nitrate reductase; EC 1.9.6.1 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see 2 papers)
27% identity, 56% coverage: 232:756/933 of query aligns to 35:599/831 of P39185
- C48 (= C239) binding
- C51 (= C242) binding
- C55 (= C246) binding
- C83 (= C273) binding
- K85 (= K275) binding
- Q152 (≠ K350) binding
- N177 (≠ C375) binding
- C181 (= C379) binding
- 214:221 (vs. 412:419, 38% identical) binding
- STFTH 245:249 (≠ DPRGQ 441:445) binding
- QTD 264:266 (≠ GTD 460:462) binding
- M375 (= M536) binding
- Q379 (= Q540) binding
- N485 (= N643) binding
- SD 511:512 (≠ QD 667:668) binding
- K534 (= K690) binding
- D561 (= D717) binding
Sites not aligning to the query:
- 1:29 signal peptide, Tat-type signal
- 721:730 binding
- 805 binding
- 822 binding
3ml1A Crystal structure of the periplasmic nitrate reductase from cupriavidus necator (see paper)
27% identity, 56% coverage: 232:756/933 of query aligns to 3:567/799 of 3ml1A
- active site: N50 (≠ L272), C51 (= C273), K53 (= K275), G119 (≠ A349), W121 (≠ C351), C149 (= C379), M150 (≠ H380), M343 (= M536), T379 (≠ R572), G380 (= G573), Q381 (= Q574)
- binding heme c: L49 (≠ R271), Y55 (≠ R277)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R17 (≠ P240), K53 (= K275), Q120 (≠ K350), N145 (≠ C375), H148 (≠ L378), C149 (= C379), W182 (≠ I412), G183 (= G413), N185 (= N415), M189 (≠ N419), S213 (≠ D441), T214 (≠ P442), F215 (≠ R443), H217 (≠ Q445), F229 (= F457), D234 (= D462), T342 (≠ G535), M343 (= M536), G344 (= G537), F345 (≠ V538), Q347 (= Q540), G380 (= G573), Q381 (= Q574), Q381 (= Q574), V451 (≠ G641), N452 (≠ E642), N453 (= N643), A457 (≠ S647), S479 (≠ Q667), D480 (= D668), S496 (≠ A684), M498 (≠ A686), K502 (= K690), D529 (= D717)
- binding iron/sulfur cluster: C16 (= C239), C19 (= C242), T21 (≠ V244), C23 (= C246), N50 (≠ L272), C51 (= C273)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 689, 690, 691, 691, 693, 695, 696, 696, 697, 697, 698, 700, 765, 773, 789, 790
1ogyC Crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides (see paper)
28% identity, 53% coverage: 239:731/933 of query aligns to 8:535/789 of 1ogyC
- active site: N42 (≠ L272), C43 (= C273), K45 (= K275), G111 (≠ A349), W113 (≠ C351), C141 (= C379), M142 (≠ H380), M335 (= M536), T371 (≠ R572), G372 (= G573), Q373 (= Q574)
- binding heme c: L41 (≠ R271), N42 (≠ L272), Y47 (≠ R277)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R9 (≠ P240), K45 (= K275), Q112 (≠ K350), N137 (≠ C375), H140 (≠ L378), C141 (= C379), G175 (= G413), N177 (= N415), E180 (= E418), M181 (≠ N419), S205 (≠ D441), T206 (≠ P442), H209 (≠ Q445), F221 (= F457), G224 (= G460), D226 (= D462), T334 (≠ G535), M335 (= M536), M335 (= M536), G336 (= G537), F337 (≠ V538), Q339 (= Q540), G372 (= G573), Q373 (= Q574), Q373 (= Q574), V443 (≠ G641), N444 (≠ E642), N445 (= N643), A449 (≠ S647), S471 (≠ Q667), D472 (= D668), A488 (= A684), M490 (≠ A686), D521 (= D717)
- binding molybdenum atom: C141 (= C379), Q373 (= Q574)
- binding iron/sulfur cluster: C8 (= C239), C11 (= C242), C15 (= C246), N42 (≠ L272), C43 (= C273), I184 (≠ V422)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 681, 682, 683, 683, 684, 685, 687, 688, 688, 689, 689, 690, 692, 757, 765, 781, 782, 783
Query Sequence
>3607874 FitnessBrowser__Dino:3607874
MADGAQLRTVTFTLDGQTVTAEAGQTIWEVANGRGLKIPHLCHKPAPGYRPDGNCRACMV
EIEGERVLAASCIREPSEGMVVTTSSARAETARKMVVEMLVTDQPARAEAHDRSAHFWDM
ADAAGVTESRFPKLEGPRIPLLDDSHVAMRVNLDACIQCGLCVRACREVQVNDVIGMAGR
GHDAYPVFDLDDPMGDSTCVACGECVQACPTGALMEAKLLDEAQQGDSKDFDDEVSSICP
FCGVGCQVSLKVKDGAIVKADGINGPANEGRLCVKGRFGFDYIHHPHRLTKPLIRRDDAP
EKGLNVDPGNPWTHFREATWEEALDAAAHGLGDLRSFYGGKSVAGFGSAKCTNEEAYLFQ
KLIRQAFGHNNVDHCTRLCHASSVAAMMENIGSGAVTATFNEIENADVAIVIGANPTENH
PVAATFFKQFAKRGGELIVLDPRGQALKRHAAHMLQFRPGTDVALLNGIMNVIVEEKLYD
RQYIEGFTEGFFEFREHIRAFTPERMAELCGIEAAQIRAVARSFARARAGMIFWGMGVSQ
HIHGTDNARCLISLALLCGHVGRPGTGLHPLRGQNNVQGASDAGLIPQVLPDYQNVTDPE
VRELFRHIWKGTQIDATPGLTVVEIMDRVYRGEIRGMYILGENPAMSDPDVEHARKALAH
LDHLVVQDIFLTETANYADVILPASAFPEKTGTVTNTNRQVQMGRKAVDAPGEAREDWRI
IVDMANRLGLDWDYDTPRMVFNEMKMSMRSLHHITWSRLENEGAVTYPSLSNDDPGQPIV
FGDGFPRRAGRAMFTPARVTPPAEVPDERYPMILTTGRQLEHWHTGSMTRRASVLDAVEP
EANCSLHPKTLRKLGVEPGGHVRLTTRRGTITVMARADRAVAEDMVFLPFAYVEAAANIL
TNAALDPYGKIPEFKFAAVRVENPLDDPQVAAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory