Comparing 3607905 FitnessBrowser__Dino:3607905 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P29914 NADH-quinone oxidoreductase chain 2; NADH dehydrogenase I, chain 2; NDH-1, chain 2; EC 7.1.1.- from Paracoccus denitrificans (see paper)
75% identity, 58% coverage: 1:234/402 of query aligns to 1:233/239 of P29914
7dgq9 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
44% identity, 49% coverage: 5:201/402 of query aligns to 1:201/207 of 7dgq9
Q9D6J6 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see paper)
45% identity, 48% coverage: 5:197/402 of query aligns to 39:235/248 of Q9D6J6
7v2cO Active state complex i from q10 dataset (see paper)
44% identity, 48% coverage: 5:197/402 of query aligns to 8:204/217 of 7v2cO
P19404 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NDUFV2; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see 2 papers)
44% identity, 48% coverage: 5:197/402 of query aligns to 40:236/249 of P19404
Sites not aligning to the query:
P04394 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH dehydrogenase subunit II; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see 2 papers)
44% identity, 48% coverage: 5:197/402 of query aligns to 40:236/249 of P04394
Sites not aligning to the query:
8eswV2 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
43% identity, 49% coverage: 5:201/402 of query aligns to 5:205/214 of 8eswV2
8b9zE Drosophila melanogaster complex i in the active state (dm1) (see paper)
43% identity, 49% coverage: 5:201/402 of query aligns to 5:205/214 of 8b9zE
5gupE structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
43% identity, 42% coverage: 13:180/402 of query aligns to 31:197/197 of 5gupE
7zmbH Cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) (see paper)
41% identity, 49% coverage: 1:196/402 of query aligns to 5:208/221 of 7zmbH
7b0nE 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
41% identity, 50% coverage: 13:211/402 of query aligns to 18:212/216 of 7b0nE
8b6fAI ndutt15 (see paper)
40% identity, 50% coverage: 13:215/402 of query aligns to 18:216/231 of 8b6fAI
8e73V2 qcr9 (see paper)
38% identity, 45% coverage: 15:195/402 of query aligns to 19:210/222 of 8e73V2
7arcE Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
36% identity, 47% coverage: 4:192/402 of query aligns to 8:210/235 of 7arcE
7a23B Plant mitochondrial respiratory complex i (see paper)
35% identity, 45% coverage: 15:195/402 of query aligns to 19:210/219 of 7a23B
3iam2 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh (see paper)
38% identity, 39% coverage: 31:187/402 of query aligns to 19:177/179 of 3iam2
Q56221 NADH-quinone oxidoreductase subunit 2; NADH dehydrogenase I chain 2; NDH-1 subunit 2; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 2 papers)
38% identity, 39% coverage: 31:187/402 of query aligns to 20:178/181 of Q56221
Sites not aligning to the query:
3i9v2 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
38% identity, 39% coverage: 31:187/402 of query aligns to 18:176/178 of 3i9v2
8e9gE Mycobacterial respiratory complex i with both quinone positions modelled (see paper)
29% identity, 38% coverage: 27:177/402 of query aligns to 36:183/233 of 8e9gE
8oh5A Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
38% identity, 34% coverage: 35:170/402 of query aligns to 16:150/150 of 8oh5A
>3607905 FitnessBrowser__Dino:3607905
MLRRLHAEQPADFAFTPENEAWALTQMTKFPEGRQASAIIPILWRAQEQEGWLSKPAIEY
VADMLDMPYIRALEVATFYFMFQLQPVGSVAHIQICGTTSCMICGAEDLVAVCKEKIAPR
AHQLSADGKFSWEEVECLGSCANAPMAQIGKDYYEDLTVESFSALLDRMAAGEVPVPGPQ
NGRYTSEPAGGLTSLTEYEAGKDPYNASARLAVDLGDTLKRIDGSEVPLTAPWLGKDAAL
PKPANRQDAPVAEAKSVAAEAAPDPAVAPAATPAEAPKVTPTAVLPGQAELATRKGNWKY
GAAAPQQGAKPKMLESARAGGADDLKKIKGVGPKLETLLNSMGIYHFDQIAAWSDAELAW
VDENLEGFKGRASRDEWVAQAKTLASGGETEFSSRVTKGDVY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory