SitesBLAST
Comparing 3607908 FitnessBrowser__Dino:3607908 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7arcF Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
72% identity, 97% coverage: 2:419/433 of query aligns to 9:425/430 of 7arcF
- binding flavin mononucleotide: G61 (= G54), R62 (= R55), K72 (= K65), N90 (= N83), D92 (= D85), E93 (= E86), S94 (= S87), Y178 (= Y171), G181 (= G174), E182 (= E175), T217 (≠ N210), N218 (= N211), L401 (= L395)
- binding iron/sulfur cluster: S352 (= S346), C353 (= C347), G354 (= G348), Q355 (= Q349), C356 (= C350), C359 (= C353), T397 (= T391), C399 (= C393), L401 (= L395)
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
73% identity, 94% coverage: 2:410/433 of query aligns to 8:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G54), R61 (= R55), G62 (= G56), K71 (= K65), N89 (= N83), D91 (= D85), Y177 (= Y171), G180 (= G174), E181 (= E175), E182 (= E176), T216 (≠ N210), N217 (= N211)
- binding iron/sulfur cluster: S351 (= S346), C352 (= C347), G353 (= G348), Q354 (= Q349), C355 (= C350), C358 (= C353), T396 (= T391), C398 (= C393), L400 (= L395)
8gymv1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
69% identity, 97% coverage: 2:420/433 of query aligns to 6:424/442 of 8gymv1
- binding flavin mononucleotide: G58 (= G54), G60 (= G56), N88 (= N83), D90 (= D85), Y176 (= Y171), E180 (= E175), E181 (= E176), T215 (≠ N210), N216 (= N211), T219 (≠ S214), A398 (= A394), L399 (= L395)
- binding iron/sulfur cluster: I177 (= I172), P195 (= P190), C351 (= C347), G352 (= G348), Q353 (= Q349), C354 (= C350), C357 (= C353), T395 (= T391), C397 (= C393), L399 (= L395), G400 (= G396)
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
68% identity, 97% coverage: 2:419/433 of query aligns to 17:433/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G54), G71 (= G56), K80 (= K65), N98 (= N83), D100 (= D85), G189 (= G174), E191 (= E176), N226 (= N211), A408 (= A394), L409 (= L395)
- binding iron/sulfur cluster: P205 (= P190), C361 (= C347), G362 (= G348), Q363 (= Q349), C364 (= C350), C367 (= C353), T405 (= T391), C407 (= C393), L409 (= L395)
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
68% identity, 97% coverage: 2:419/433 of query aligns to 15:431/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G54), G69 (= G56), K78 (= K65), N96 (= N83), D98 (= D85), E99 (= E86), G187 (= G174), E188 (= E175), N224 (= N211), A406 (= A394)
- binding iron/sulfur cluster: I185 (= I172), P203 (= P190), C359 (= C347), Q361 (= Q349), C362 (= C350), C365 (= C353), T403 (= T391), I404 (= I392), C405 (= C393), L407 (= L395)
- binding : Y143 (≠ I130), N144 (≠ R131), Q150 (= Q137), D174 (= D161)
Q91YT0 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see 2 papers)
68% identity, 97% coverage: 2:419/433 of query aligns to 35:451/464 of Q91YT0
- C379 (= C347) binding
- C382 (= C350) binding
- C385 (= C353) binding
- C425 (= C393) binding
Sites not aligning to the query:
- 1:20 modified: transit peptide, Mitochondrion
5lnk1 Entire ovine respiratory complex i (see paper)
68% identity, 97% coverage: 2:419/433 of query aligns to 9:425/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P89), G97 (= G90)
- binding flavin mononucleotide: G61 (= G54), R62 (= R55), K72 (= K65), N90 (= N83), D92 (= D85), E93 (= E86), G94 (≠ S87), Y178 (= Y171), G181 (= G174), E182 (= E175), V216 (= V209), A217 (≠ N210), N218 (= N211), T221 (≠ S214), L401 (= L395)
- binding iron/sulfur cluster: P197 (= P190), S352 (= S346), C353 (= C347), Q355 (= Q349), C356 (= C350), C359 (= C353), T397 (= T391), I398 (= I392), C399 (= C393)
P25708 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see paper)
68% identity, 96% coverage: 2:418/433 of query aligns to 35:450/464 of P25708
- C379 (= C347) binding
- C382 (= C350) binding
- C385 (= C353) binding
- C425 (= C393) binding
6zk91 Peripheral domain of open complex i during turnover (see paper)
68% identity, 97% coverage: 2:419/433 of query aligns to 7:423/430 of 6zk91
- binding flavin mononucleotide: G59 (= G54), G61 (= G56), K70 (= K65), N88 (= N83), D90 (= D85), E91 (= E86), G179 (= G174), E180 (= E175), A215 (≠ N210), N216 (= N211), A398 (= A394), L399 (= L395)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G56), G62 (= G57), A63 (= A58), F65 (= F60), K70 (= K65), E93 (= E88), Y176 (= Y171), E181 (= E176), F201 (= F196), T323 (= T319)
- binding iron/sulfur cluster: I177 (= I172), P195 (= P190), C351 (= C347), G352 (= G348), Q353 (= Q349), C354 (= C350), C357 (= C353), T395 (= T391), C397 (= C393), L399 (= L395)
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
68% identity, 97% coverage: 2:419/433 of query aligns to 4:420/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G56), K67 (= K65), N85 (= N83), D87 (= D85), E88 (= E86), G89 (≠ S87), C175 (= C173), G176 (= G174), A212 (≠ N210), N213 (= N211)
- binding iron/sulfur cluster: S347 (= S346), C348 (= C347), G349 (= G348), C351 (= C350), C354 (= C353), C394 (= C393), L396 (= L395)
- binding : R121 (≠ H119), Y132 (≠ I130), Q139 (= Q137), R143 (≠ D141), Y146 (= Y144), E147 (= E145), F165 (≠ Y163), R168 (≠ H166)
7v2cA Active state complex i from q10 dataset (see paper)
68% identity, 97% coverage: 2:419/433 of query aligns to 10:426/433 of 7v2cA
- binding flavin mononucleotide: G62 (= G54), K73 (= K65), N91 (= N83), Y179 (= Y171), G182 (= G174), E183 (= E175), N219 (= N211), A401 (= A394), L402 (= L395)
- binding iron/sulfur cluster: P198 (= P190), C354 (= C347), G355 (= G348), Q356 (= Q349), C357 (= C350), C360 (= C353), T398 (= T391), C400 (= C393), L402 (= L395)
P49821 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see paper)
68% identity, 97% coverage: 2:419/433 of query aligns to 35:451/464 of P49821
- C379 (= C347) binding
- C382 (= C350) binding
- C385 (= C353) binding
- C425 (= C393) binding
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
66% identity, 97% coverage: 2:419/433 of query aligns to 6:425/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G56), K69 (= K65), N90 (= N83), D92 (= D85), E93 (= E86), G94 (≠ S87), Y178 (= Y171), G181 (= G174), E182 (= E175), N218 (= N211)
- binding iron/sulfur cluster: P197 (= P190), S352 (= S346), C353 (= C347), Q355 (= Q349), C356 (= C350), C359 (= C353), T397 (= T391), C399 (= C393)
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
66% identity, 97% coverage: 2:419/433 of query aligns to 5:424/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G54), G59 (= G56), K68 (= K65), N89 (= N83), D91 (= D85), E92 (= E86), G180 (= G174), E181 (= E175), E182 (= E176), T216 (≠ N210), N217 (= N211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G56), G60 (= G57), F63 (= F60), K68 (= K65), E94 (= E88), Y177 (= Y171), E182 (= E176), F202 (= F196), T324 (= T319)
- binding iron/sulfur cluster: P196 (= P190), S351 (= S346), C352 (= C347), G353 (= G348), Q354 (= Q349), C355 (= C350), C358 (= C353), T396 (= T391), C398 (= C393), L400 (= L395)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
65% identity, 98% coverage: 2:424/433 of query aligns to 7:433/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G54), G61 (= G56), K70 (= K65), N91 (= N83), D93 (= D85), G182 (= G174), E183 (= E175), E184 (= E176), A218 (≠ N210), N219 (= N211), A401 (= A394), L402 (= L395)
- binding iron/sulfur cluster: P198 (= P190), C354 (= C347), G355 (= G348), Q356 (= Q349), C357 (= C350), C360 (= C353), T398 (= T391), C400 (= C393), L402 (= L395)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
49% identity, 90% coverage: 24:413/433 of query aligns to 34:420/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
49% identity, 90% coverage: 24:413/433 of query aligns to 33:419/437 of 4hea1
- binding flavin mononucleotide: G63 (= G54), K74 (= K65), N91 (= N83), D93 (= D85), Y179 (= Y171), G182 (= G174), E183 (= E175), N218 (= N210), N219 (= N211), L401 (= L395)
- binding iron/sulfur cluster: I180 (= I172), P198 (= P190), S351 (= S346), C352 (= C347), G353 (= G348), K354 (≠ Q349), C355 (= C350), C358 (= C353), F398 (≠ I392), C399 (= C393), L401 (= L395)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
49% identity, 90% coverage: 24:413/433 of query aligns to 33:419/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G54), G65 (= G56), N91 (= N83), D93 (= D85), G182 (= G174), E183 (= E175), E184 (= E176), N218 (= N210), N219 (= N211), T222 (≠ S214), P400 (≠ A394)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G56), G66 (= G57), F69 (= F60), K74 (= K65), F77 (= F68), E96 (= E88), Y179 (= Y171), E184 (= E176), K201 (= K193), F204 (= F196), T324 (= T319)
- binding iron/sulfur cluster: S351 (= S346), C352 (= C347), K354 (≠ Q349), C355 (= C350), C358 (= C353), F398 (≠ I392), C399 (= C393), L401 (= L395), A402 (≠ G396)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
50% identity, 91% coverage: 19:413/433 of query aligns to 18:416/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G54), R54 (= R55), G55 (= G56), A57 (= A58), K64 (= K65), N90 (= N83), D92 (= D85), Y178 (= Y171), G181 (= G174), E182 (= E175), E183 (= E176), N217 (= N210), N218 (= N211), S221 (= S214), L398 (= L395)
- binding iron/sulfur cluster: P197 (= P190), S349 (= S346), C350 (= C347), G351 (= G348), K352 (≠ Q349), C353 (= C350), C356 (= C353), S394 (≠ T391), F395 (≠ I392), C396 (= C393), L398 (= L395), G399 (= G396)
- binding zinc ion: C333 (≠ D330), E371 (≠ V368)
Sites not aligning to the query:
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
45% identity, 91% coverage: 24:419/433 of query aligns to 30:424/442 of 7p61F
- binding flavin mononucleotide: G61 (= G54), G63 (= G56), K72 (= K65), N90 (= N83), D92 (= D85), G181 (= G174), E182 (= E175), N217 (= N210), N218 (= N211), A399 (= A394), H400 (≠ L395)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G56), G64 (= G57), A65 (= A58), F67 (= F60), K72 (= K65), L75 (≠ F68), E95 (= E88), Y178 (= Y171), E183 (= E176), F203 (= F196), R320 (≠ G316), T323 (= T319)
- binding iron/sulfur cluster: S350 (= S346), C351 (= C347), W353 (≠ Q349), C354 (= C350), C357 (= C353), F397 (≠ I392), C398 (= C393), H400 (≠ L395)
Query Sequence
>3607908 FitnessBrowser__Dino:3607908
MLQDQDRIFTNIYGMHDRTLAGARKRGHWDGTDKLIQMGRDDIVKIMKDSGLRGRGGAGF
PTGLKWSFMPKESDGRPHYLVVNADESEPGTCKDREIMRHDPHTLIEGCLIASFAMGAHA
SYIYIRGEYIREREALQAAIDEAYEAGLLGKNAAGSGWDFDLYLTHGAGAYICGEETALI
ESLEGKKGMPRMKPPFPAGAGLYGCPTTVNNVESIAVVPTILRRGADWFAQFGRPNNAGT
KLFAISGHVNQPCVVEEAMSISFEELIDKHCGGIRGGWDNLKAVIPGGSSVPCVRGENMR
DAIMDFDYLRGELGSGLGTAAVIVMDQSTDIIKAIWRLSAFYKHESCGQCTPCREGTGWM
MRVMDRLVRGEAEVEEIDMLFDVTKQVEGHTICALGDAAAWPIQGLIRNFRDEIEDRIKA
QKTGRVTAALAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory