SitesBLAST
Comparing 3607933 FitnessBrowser__Dino:3607933 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 77% coverage: 7:285/362 of query aligns to 16:302/378 of P69874
- C26 (≠ D17) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F18) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ V36) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C45) mutation to T: Loss of ATPase activity and transport.
- L60 (= L51) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V67) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V127) mutation to M: Loss of ATPase activity and transport.
- D172 (= D164) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ F259) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (≠ Q280) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
38% identity, 76% coverage: 9:284/362 of query aligns to 4:284/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (= F18), Q14 (= Q19), T16 (≠ Q21), V18 (= V23), S38 (= S43), G39 (= G44), C40 (= C45), G41 (= G46), K42 (= K47), T43 (≠ S48), T44 (= T49), R133 (≠ K135), E137 (≠ Q139), S139 (= S141), G141 (= G143), Q142 (≠ E144)
- binding calcium ion: T43 (≠ S48), Q86 (= Q91)
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 77% coverage: 8:287/362 of query aligns to 3:286/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 77% coverage: 8:287/362 of query aligns to 3:286/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 77% coverage: 8:287/362 of query aligns to 3:286/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
37% identity, 77% coverage: 8:287/362 of query aligns to 3:286/353 of Q97UY8
- S142 (= S141) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G143) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E165) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 88% coverage: 6:322/362 of query aligns to 4:332/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 93% coverage: 23:358/362 of query aligns to 18:353/369 of P19566
- L86 (= L95) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P166) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D171) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (≠ R311) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1g291 Malk (see paper)
39% identity, 68% coverage: 24:269/362 of query aligns to 19:270/372 of 1g291
- binding magnesium ion: D69 (≠ S74), E71 (≠ D76), K72 (vs. gap), K79 (≠ E82), D80 (≠ A83)
- binding pyrophosphate 2-: S38 (= S43), G39 (= G44), C40 (= C45), G41 (= G46), K42 (= K47), T43 (≠ S48), T44 (= T49)
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
33% identity, 93% coverage: 23:358/362 of query aligns to 15:352/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S43), G36 (= G44), C37 (= C45), G38 (= G46), K39 (= K47), S40 (= S48), T41 (= T49), R126 (≠ K135), A130 (≠ Q139), S132 (= S141), G134 (= G143), Q135 (≠ E144)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 93% coverage: 23:358/362 of query aligns to 18:355/371 of P68187
- A85 (= A94) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ R113) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A120) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L123) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D125) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ L130) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G143) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D164) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ K234) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (= F240) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (≠ L263) mutation to G: Normal maltose transport but constitutive mal gene expression.
- G278 (= G270) mutation to P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- S282 (≠ E274) mutation to L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G284 (≠ V276) mutation to S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G302 (= G305) mutation to D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- E308 (≠ R311) mutation to Q: Maltose transport is affected but retains ability to interact with MalT.
- S322 (≠ F325) mutation to F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G340 (= G343) mutation to A: Maltose transport is affected but retains ability to interact with MalT.
- G346 (≠ S349) mutation to S: Normal maltose transport but constitutive mal gene expression.
- F355 (= F358) mutation to Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
33% identity, 93% coverage: 23:358/362 of query aligns to 17:354/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S43), G38 (= G44), C39 (= C45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), Q81 (= Q91), R128 (≠ K135), A132 (≠ Q139), S134 (= S141), G136 (= G143), Q137 (≠ E144), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (= S48), Q81 (= Q91)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
33% identity, 93% coverage: 23:358/362 of query aligns to 17:354/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G44), C39 (= C45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (≠ K135), S134 (= S141), Q137 (≠ E144)
- binding beryllium trifluoride ion: S37 (= S43), G38 (= G44), K41 (= K47), Q81 (= Q91), S134 (= S141), G136 (= G143), H191 (= H198)
- binding magnesium ion: S42 (= S48), Q81 (= Q91)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
33% identity, 93% coverage: 23:358/362 of query aligns to 17:354/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (= V23), G38 (= G44), C39 (= C45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (≠ K135), A132 (≠ Q139), S134 (= S141), Q137 (≠ E144)
- binding tetrafluoroaluminate ion: S37 (= S43), G38 (= G44), K41 (= K47), Q81 (= Q91), S134 (= S141), G135 (= G142), G136 (= G143), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (= S48), Q81 (= Q91)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
33% identity, 93% coverage: 23:358/362 of query aligns to 17:354/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (= V23), G38 (= G44), C39 (= C45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (≠ K135), A132 (≠ Q139), S134 (= S141), Q137 (≠ E144)
- binding magnesium ion: S42 (= S48), Q81 (= Q91)
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
33% identity, 93% coverage: 23:358/362 of query aligns to 17:354/374 of 2awnB
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
33% identity, 97% coverage: 9:358/362 of query aligns to 7:344/353 of 1vciA
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 75% coverage: 11:283/362 of query aligns to 6:288/393 of P9WQI3
- H193 (= H198) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 65% coverage: 9:243/362 of query aligns to 4:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 65% coverage: 9:243/362 of query aligns to 4:241/242 of 3c41J
Query Sequence
>3607933 FitnessBrowser__Dino:3607933
MKHQPIPRLEVSHLVRDFQGQRVVDDVSIRVMPGQVTCLLGPSGCGKSTTLRIIAGVDRQ
DSGTLTVDGEVVSSDDIHLPPEARSVGLMFQDFALFPHLCVADNVGFGLSGSRKEKRARA
HELLDRVGLLGDAGKFPHQLSGGEQQRVALARAIAPRPRVMLMDEPFSGLDNRLRDGIRD
ETLEVLKDEGTAVLLVTHEPEEAMRMADNIALMRGGKIVQQGAPYNVYNSPVDKAAAAFF
SDINVIESTVQGALTETPFGQFLAPGVPNGGRVEIVIRPQHLRIDFDRNGQGPLPTPQDG
TPARGTVQRARFMGAESLVEFRMDFDDVILRAKVPGVFMPKPGTVLWLSMRRDRCFVFPA
RD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory