SitesBLAST
Comparing 3607950 FitnessBrowser__Dino:3607950 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
38% identity, 95% coverage: 12:255/258 of query aligns to 2:242/243 of 4i08A
- active site: G19 (= G29), N113 (= N122), S141 (= S149), Q151 (≠ V159), Y154 (= Y162), K158 (= K166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G25), S17 (= S27), R18 (≠ S28), I20 (= I30), T40 (≠ R50), N62 (≠ D75), V63 (= V76), N89 (= N98), A90 (≠ S99), G140 (≠ A148), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (= G193), T189 (= T197)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 95% coverage: 12:255/258 of query aligns to 2:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G25), S17 (= S27), R18 (≠ S28), I20 (= I30), T40 (≠ R50), N62 (≠ D75), V63 (= V76), N89 (= N98), A90 (≠ S99), I92 (≠ V101), V139 (= V147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (= G193), I187 (= I195), T189 (= T197), M191 (≠ I199)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
38% identity, 95% coverage: 14:257/258 of query aligns to 12:261/261 of 5u9pB
- active site: G27 (= G29), S152 (= S149), Y165 (= Y162), K169 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G25), R26 (≠ S28), G27 (= G29), I28 (= I30), R48 (= R50), D73 (= D75), V74 (= V76), N100 (= N98), A101 (≠ S99), I150 (≠ V147), Y165 (= Y162), K169 (= K166), P195 (= P192), F198 (≠ I195), T200 (= T197), L202 (≠ I199), N203 (= N200)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 92% coverage: 19:255/258 of query aligns to 5:246/246 of 3osuA
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
40% identity, 96% coverage: 9:256/258 of query aligns to 3:254/254 of 4ag3A
- active site: G23 (= G29), S148 (= S149), Y161 (= Y162), K165 (= K166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G25), S21 (= S27), R22 (≠ S28), G23 (= G29), I24 (= I30), T44 (≠ R50), L68 (= L74), D69 (= D75), V70 (= V76), N96 (= N98), A97 (≠ S99), I146 (≠ V147), S148 (= S149), Y161 (= Y162), K165 (= K166), P191 (= P192), G192 (= G193), F193 (≠ Y194), I194 (= I195), T196 (= T197), M198 (≠ I199), T199 (≠ N200)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
40% identity, 94% coverage: 11:252/258 of query aligns to 1:242/246 of 4hp8B
- active site: G19 (= G29), S138 (= S149), V148 (= V159), Y151 (= Y162), K155 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G25), N17 (≠ S27), T18 (≠ S28), G19 (= G29), L20 (≠ I30), R40 (= R50), R41 (= R51), D63 (= D75), F64 (≠ V76), N85 (= N98), G87 (= G100), I88 (≠ V101), I136 (≠ V147), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (= G193), I184 (= I195), T186 (= T197), N188 (= N200), T189 (= T201)
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
40% identity, 95% coverage: 9:252/258 of query aligns to 9:251/255 of 4bo4C
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 92% coverage: 19:255/258 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G29), S138 (= S149), Q148 (≠ V159), Y151 (= Y162), K155 (= K166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G25), S10 (= S27), R11 (≠ S28), I13 (= I30), N31 (≠ L47), Y32 (≠ A48), A33 (= A49), G34 (≠ R50), S35 (≠ R51), A58 (≠ L74), N59 (≠ D75), V60 (= V76), N86 (= N98), A87 (≠ S99), T109 (= T121), S138 (= S149), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (= G193)
4bo1A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(4-chloro-2,5- dimethoxyphenyl)quinoline-8-carboxamide at 2.2a resolution (see paper)
40% identity, 96% coverage: 9:256/258 of query aligns to 1:237/237 of 4bo1A
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
39% identity, 95% coverage: 10:255/258 of query aligns to 3:253/254 of 3lqfA
- active site: G22 (= G29), S144 (= S149), Y159 (= Y162), K163 (= K166)
- binding meso-erythritol: N151 (≠ L156), Y159 (= Y162), Y191 (= Y194), T197 (≠ N200), M200 (≠ F203)
- binding nicotinamide-adenine-dinucleotide: G18 (= G25), S21 (= S28), G22 (= G29), I23 (= I30), D42 (≠ A49), R43 (= R50), D66 (= D75), V67 (= V76), S92 (≠ N98), L142 (≠ V147), S144 (= S149), K163 (= K166), P189 (= P192), V192 (≠ I195), T194 (= T197), M196 (≠ I199), T197 (≠ N200)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
39% identity, 95% coverage: 10:255/258 of query aligns to 3:253/254 of 2wsbA
- active site: G22 (= G29), S144 (= S149), Y159 (= Y162), K163 (= K166)
- binding nicotinamide-adenine-dinucleotide: G18 (= G25), S21 (= S28), G22 (= G29), I23 (= I30), D42 (≠ A49), R43 (= R50), D66 (= D75), V67 (= V76), S92 (≠ N98), A93 (≠ S99), L142 (≠ V147), S144 (= S149), Y159 (= Y162), K163 (= K166), P189 (= P192), V192 (≠ I195), T194 (= T197), M196 (≠ I199), T197 (≠ N200)
- binding n-propanol: S144 (= S149), M145 (≠ I150), N151 (≠ L156), N151 (≠ L156), Y159 (= Y162), Y159 (= Y162), Y191 (= Y194)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
39% identity, 95% coverage: 10:255/258 of query aligns to 3:253/254 of 2wdzA
- active site: G22 (= G29), S144 (= S149), Y159 (= Y162), K163 (= K166)
- binding (2S)-pentane-1,2-diol: A45 (= A52), D49 (≠ E56), R62 (≠ T71), S146 (≠ L151), Y159 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G18 (= G25), S21 (= S28), G22 (= G29), I23 (= I30), D42 (≠ A49), R43 (= R50), A65 (≠ L74), D66 (= D75), V67 (= V76), S92 (≠ N98), A93 (≠ S99), L142 (≠ V147), S144 (= S149), Y159 (= Y162), K163 (= K166), P189 (= P192), V192 (≠ I195), T194 (= T197), M196 (≠ I199), T197 (≠ N200)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
39% identity, 95% coverage: 10:255/258 of query aligns to 3:253/254 of C0KTJ6
Sites not aligning to the query:
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
36% identity, 93% coverage: 16:255/258 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G29), S138 (= S149), Y151 (= Y162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G25), S14 (= S27), R15 (≠ S28), T37 (≠ R50), L58 (= L74), N59 (≠ D75), V60 (= V76), A87 (≠ S99), G88 (= G100), I89 (≠ V101)
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
41% identity, 93% coverage: 16:256/258 of query aligns to 5:241/241 of 4bnzA
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
38% identity, 90% coverage: 21:252/258 of query aligns to 4:252/256 of 1xr3A
- active site: G12 (= G29), N109 (= N122), S139 (= S149), Y152 (= Y162), K156 (= K166), Y197 (vs. gap)
- binding 4-(diazenylcarbonyl)pyridine: T140 (≠ I150), G141 (≠ L151), V146 (≠ L156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G25), T10 (≠ S27), S11 (= S28), G12 (= G29), I13 (= I30), A32 (= A49), R33 (= R50), G34 (≠ R51), C57 (≠ L74), D58 (= D75), V59 (= V76), N85 (= N98), A86 (≠ S99), G87 (= G100), S139 (= S149), Y152 (= Y162), K156 (= K166), G183 (= G193), V185 (≠ I195), T187 (= T197), P188 (= P198)
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
38% identity, 90% coverage: 21:252/258 of query aligns to 7:255/259 of 1w4zA
- active site: G15 (= G29), N112 (= N122), S142 (= S149), Y155 (= Y162), K159 (= K166), Y200 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G25), T13 (≠ S27), S14 (= S28), G15 (= G29), I16 (= I30), R36 (= R50), G37 (≠ R51), D61 (= D75), V62 (= V76), N88 (= N98), G90 (= G100), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), G186 (= G193), V188 (≠ I195), T190 (= T197)
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
38% identity, 90% coverage: 21:252/258 of query aligns to 5:253/257 of 2rh4A
- active site: G13 (= G29), N110 (= N122), S140 (= S149), Y153 (= Y162), K157 (= K166), Y198 (vs. gap)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ I150), Q145 (≠ G154), V147 (≠ L156), Y153 (= Y162), F185 (≠ Y194)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G25), T11 (≠ S27), S12 (= S28), G13 (= G29), I14 (= I30), A33 (= A49), R34 (= R50), G35 (≠ R51), C58 (≠ L74), D59 (= D75), V60 (= V76), N86 (= N98), G88 (= G100), S140 (= S149), Y153 (= Y162), K157 (= K166), P183 (= P192), G184 (= G193), V186 (≠ I195), T188 (= T197), M190 (≠ I199)
Sites not aligning to the query:
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
38% identity, 90% coverage: 21:252/258 of query aligns to 16:264/268 of 2rh4B
- active site: G24 (= G29), N121 (= N122), S151 (= S149), Y164 (= Y162), K168 (= K166), Y209 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G25), T22 (≠ S27), S23 (= S28), I25 (= I30), A44 (= A49), R45 (= R50), G46 (≠ R51), C69 (≠ L74), D70 (= D75), V71 (= V76), N97 (= N98), S151 (= S149), Y164 (= Y162), K168 (= K166), G195 (= G193), V197 (≠ I195), T199 (= T197), M201 (≠ I199)
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
38% identity, 90% coverage: 21:252/258 of query aligns to 9:257/261 of P16544
- 11:39 (vs. 23:51, 48% identical) binding
- D63 (= D75) binding
- K161 (= K166) binding
Query Sequence
>3607950 FitnessBrowser__Dino:3607950
MQEVVQAALFKRLFGLEGKRALITGASSGIGAHLALTLGQAGAEVILAARRADRLEAVAE
TLRAEGIVAQTAALDVTDAASVAAAVTTVGPLDILINNSGVSGQDMVIDTTEADWDRVLD
TNLKGAWRVSRAFAPGLIARQGTILNVASILGIGVLKTVGPYAASKAGLIQLTRAMALEL
ARDGVRVNALAPGYIETPINTEFFASEAGQKMLRGVPQRRLGQPGDLDAAVLMLLGPGAG
FVTGATVVVDGGHTLALS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory