SitesBLAST
Comparing 3607958 FitnessBrowser__Dino:3607958 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
69% identity, 98% coverage: 10:441/441 of query aligns to 7:439/439 of Q9A3Q9
- V227 (= V229) mutation to G: Decreases activity toward 3-aminobutanoate by 2-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 2-fold.
- R260 (= R262) mutation to L: Decreases activity toward 3-aminobutanoate by 30-fold.
- N285 (= N287) mutation to A: Decreases activity toward 3-aminobutanoate by 4-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 3-fold.
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
50% identity, 97% coverage: 11:437/441 of query aligns to 16:444/448 of Q9I700
- W61 (= W56) binding
- T327 (= T320) binding
- R414 (= R407) binding
- Q421 (≠ A414) binding
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
50% identity, 97% coverage: 11:437/441 of query aligns to 9:437/441 of 4b98A
- active site: F17 (= F19), Y146 (= Y148), E219 (= E221), D252 (= D254), I255 (= I257), K281 (= K283), Q414 (≠ A414)
- binding pyridoxal-5'-phosphate: G233 (= G235), Q236 (= Q238), F270 (= F272), G271 (= G273)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: L53 (= L55), W54 (= W56), F82 (= F84), S112 (= S114), G113 (= G115), S114 (= S116), Y146 (= Y148), H147 (= H149), G148 (= G150), E219 (= E221), S224 (= S226), D252 (= D254), V254 (= V256), I255 (= I257), K281 (= K283), Y319 (= Y319), T320 (= T320), R407 (= R407), Q414 (≠ A414)
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
49% identity, 97% coverage: 11:437/441 of query aligns to 3:431/435 of 4uhmA
- active site: F11 (= F19), Y140 (= Y148), E213 (= E221), D246 (= D254), I249 (= I257), K275 (= K283), Q408 (≠ A414)
- binding magnesium ion: A91 (≠ V99), D99 (= D107)
- binding pyridoxal-5'-phosphate: G107 (= G115), S108 (= S116), Y140 (= Y148), H141 (= H149), G142 (= G150), E213 (= E221), D246 (= D254), V248 (= V256), I249 (= I257), K275 (= K283)
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
50% identity, 97% coverage: 12:440/441 of query aligns to 9:440/441 of 3a8uX
- active site: Y145 (= Y148), D252 (= D254), K281 (= K283), Q414 (≠ A414)
- binding pyridoxal-5'-phosphate: S111 (= S114), G112 (= G115), S113 (= S116), Y145 (= Y148), H146 (= H149), G147 (= G150), E219 (= E221), D252 (= D254), V254 (= V256), I255 (= I257), K281 (= K283)
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
41% identity, 97% coverage: 10:438/441 of query aligns to 5:444/447 of 5lhaA
- active site: Y146 (= Y148), D253 (= D254), K282 (= K283), T319 (= T320)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G115), S114 (= S116), Y146 (= Y148), H147 (= H149), G148 (= G150), E220 (= E221), D253 (= D254), K282 (= K283), Y318 (= Y319), T319 (= T320)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
41% identity, 97% coverage: 10:438/441 of query aligns to 7:446/449 of 5lh9D
- active site: Y148 (= Y148), D255 (= D254), K284 (= K283), T321 (= T320)
- binding pyridoxal-5'-phosphate: G115 (= G115), S116 (= S116), Y148 (= Y148), H149 (= H149), G150 (= G150), E222 (= E221), D255 (= D254), V257 (= V256), K284 (= K283)
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
37% identity, 94% coverage: 18:431/441 of query aligns to 17:436/450 of 6gwiB
- active site: F18 (= F19), Y149 (= Y148), D255 (= D254), K284 (= K283)
- binding pyridoxal-5'-phosphate: S115 (= S114), G116 (= G115), S117 (= S116), Y149 (= Y148), H150 (= H149), G151 (= G150), E222 (= E221), D255 (= D254), V257 (= V256), I258 (= I257), K284 (= K283)
6s54A Transaminase from pseudomonas fluorescens (see paper)
35% identity, 94% coverage: 26:439/441 of query aligns to 28:450/453 of 6s54A
- active site: Y152 (= Y148), D258 (= D254), K287 (= K283)
- binding pyridoxal-5'-phosphate: G119 (= G115), S120 (= S116), Y152 (= Y148), H153 (= H149), G154 (= G150), E225 (= E221), D258 (= D254), V260 (= V256), I261 (= I257), K287 (= K283)
Sites not aligning to the query:
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 93% coverage: 30:437/441 of query aligns to 31:449/455 of 5kr5A
- binding calcium ion: E66 (≠ P65), D70 (≠ E69), D412 (≠ K402), E447 (= E435)
- binding pyridoxal-5'-phosphate: S117 (= S114), G118 (= G115), S119 (= S116), Y151 (= Y148), H152 (= H149), G153 (= G150), E224 (= E221), D257 (= D254), V259 (= V256), K286 (= K283), W322 (≠ Y319), T323 (= T320)
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 95% coverage: 11:430/441 of query aligns to 12:443/458 of 5kr3A
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
33% identity, 98% coverage: 11:440/441 of query aligns to 13:456/460 of 5kr6B
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
34% identity, 97% coverage: 10:438/441 of query aligns to 11:444/448 of 6io1B
- active site: L20 (≠ F19), Y151 (= Y148), D257 (= D254), K286 (= K283)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ S114), G118 (= G115), A119 (≠ S116), N122 (≠ V119), Y151 (= Y148), H152 (= H149), D257 (= D254), V259 (= V256), I260 (= I257), K286 (= K283)
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
33% identity, 97% coverage: 11:437/441 of query aligns to 7:435/443 of 6fyqA
- active site: F15 (= F19), Y147 (= Y148), D243 (= D254), K272 (= K283)
- binding pyridoxal-5'-phosphate: G114 (= G115), S115 (= S116), Y147 (= Y148), H148 (= H149), G149 (= G150), E210 (= E221), D243 (= D254), V245 (= V256), I246 (= I257), K272 (= K283)
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
35% identity, 93% coverage: 26:437/441 of query aligns to 22:434/444 of 3i5tA
- active site: Y144 (= Y148), E216 (= E221), D249 (= D254), V252 (≠ I257), K279 (= K283), V411 (≠ A414)
- binding pyridoxal-5'-phosphate: G111 (= G115), S112 (= S116), Y144 (= Y148), H145 (= H149), E216 (= E221), D249 (= D254), V251 (= V256), K279 (= K283), Y315 (= Y319), T316 (= T320)
Sites not aligning to the query:
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
34% identity, 91% coverage: 30:431/441 of query aligns to 2:408/422 of 7qx3A
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
33% identity, 96% coverage: 18:441/441 of query aligns to 16:445/453 of 6s4gA
- active site: F17 (= F19), Y148 (= Y148), D254 (= D254), K283 (= K283)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S114 (= S114), G115 (= G115), S116 (= S116), Y148 (= Y148), H149 (= H149), G150 (= G150), E221 (= E221), D254 (= D254), V256 (= V256), I257 (= I257), K283 (= K283), F315 (≠ Y319), T316 (= T320)
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
36% identity, 92% coverage: 26:430/441 of query aligns to 27:437/454 of 7ypmA
- binding alanine: W57 (= W56), Y150 (= Y148)
- binding pyridoxal-5'-phosphate: S116 (= S114), G117 (= G115), S118 (= S116), Y150 (= Y148), G152 (= G150), E223 (= E221), D256 (= D254), V258 (= V256), I259 (= I257), K285 (= K283)
7q9xAAA Probable aminotransferase
33% identity, 96% coverage: 18:441/441 of query aligns to 17:446/455 of 7q9xAAA
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: L55 (= L55), W56 (= W56), S115 (= S114), G116 (= G115), S117 (= S116), Y149 (= Y148), G151 (= G150), E222 (= E221), D255 (= D254), V257 (= V256), I258 (= I257), K284 (= K283), F316 (≠ Y319), T317 (= T320), R412 (= R407)
- binding pyridoxal-5'-phosphate: F316 (≠ Y319), T317 (= T320)
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
33% identity, 96% coverage: 18:441/441 of query aligns to 17:446/455 of 4a6tC
- active site: F18 (= F19), Y149 (= Y148), E222 (= E221), D255 (= D254), I258 (= I257), K284 (= K283), V419 (≠ A414)
- binding pyridoxal-5'-phosphate: G116 (= G115), S117 (= S116), Y149 (= Y148), H150 (= H149), G151 (= G150), E222 (= E221), D255 (= D254), V257 (= V256), I258 (= I257), K284 (= K283)
Query Sequence
>3607958 FitnessBrowser__Dino:3607958
MALDAKSRPNDLSAFWMPFTANRQFKSNPRMFVAADGMYYTTAEGRQVLDGTAGLWCCNA
GHKRPRIVEAIQAQAAELDYAPAFQMGHPRAFELANRLVEIAPDGMDHVFYTNSGSEAVE
SALKIALAYHRARGEAGRTRLIGRERGYHGVNFGGISVGGIVNNRKHFGTLLTGVDHLPH
THIPENQWSRGMPELGAHLADDLERIIALHGAETIAAVIVEPMAGSTGVLLPPKGYLQRL
RKITQDHGIVLIFDEVITGFGRVGAAFGAQRFGVTPDMITCAKGLTNGVIPMGAVLCGSH
IHDAFMQGPENLIELFHGYTYSGNPIASAAGLATLETYREDDLFARALDLEPYWQEALHS
LKGARHVIDIRNLGLIGAIELEPISGHPTKRAFQAFLDAYDKGVLIRTTGDIIALSPPLI
IETAQIDRIVETLGEVLAALD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory