SitesBLAST
Comparing 3607963 FitnessBrowser__Dino:3607963 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
38% identity, 68% coverage: 88:314/333 of query aligns to 13:238/257 of 8wm7D
8w9mD Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
38% identity, 68% coverage: 88:314/333 of query aligns to 11:236/256 of 8w9mD
- binding adenosine-5'-triphosphate: Y12 (≠ F89), H40 (≠ P117), S41 (= S118), G42 (= G119), G44 (= G121), K45 (= K122), S46 (≠ T123), T47 (= T124), Q82 (= Q161), Q135 (= Q212), S137 (= S214), G139 (= G216), M140 (= M217), H194 (= H271)
- binding magnesium ion: S46 (≠ T123), Q82 (= Q161)
8wm7C Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
37% identity, 74% coverage: 78:322/333 of query aligns to 1:248/658 of 8wm7C
8w9mC Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
36% identity, 74% coverage: 78:322/333 of query aligns to 1:248/256 of 8w9mC
- binding adenosine-5'-triphosphate: F12 (= F89), Y20 (≠ V96), S42 (= S118), G43 (= G119), G45 (= G121), K46 (= K122), S47 (≠ T123), T48 (= T124), Q83 (= Q161), K132 (= K208), E136 (≠ Q212), S138 (= S214), G140 (= G216), H195 (= H271)
- binding magnesium ion: S47 (≠ T123), Q83 (= Q161)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 63% coverage: 94:303/333 of query aligns to 14:221/369 of P19566
- L86 (= L165) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P239) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D244) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 61% coverage: 94:296/333 of query aligns to 37:244/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
37% identity, 61% coverage: 94:296/333 of query aligns to 37:244/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 63% coverage: 94:303/333 of query aligns to 13:220/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
40% identity, 63% coverage: 94:303/333 of query aligns to 13:220/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S118), G38 (= G119), C39 (= C120), G40 (= G121), K41 (= K122), S42 (≠ T123), T43 (= T124), Q81 (= Q161), R128 (≠ K208), A132 (≠ Q212), S134 (= S214), G136 (= G216), Q137 (≠ M217), E158 (= E238), H191 (= H271)
- binding magnesium ion: S42 (≠ T123), Q81 (= Q161)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
40% identity, 63% coverage: 94:303/333 of query aligns to 13:220/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G119), C39 (= C120), G40 (= G121), K41 (= K122), S42 (≠ T123), T43 (= T124), R128 (≠ K208), S134 (= S214), Q137 (≠ M217)
- binding beryllium trifluoride ion: S37 (= S118), G38 (= G119), K41 (= K122), Q81 (= Q161), S134 (= S214), G136 (= G216), H191 (= H271)
- binding magnesium ion: S42 (≠ T123), Q81 (= Q161)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
40% identity, 63% coverage: 94:303/333 of query aligns to 13:220/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (≠ A98), G38 (= G119), C39 (= C120), G40 (= G121), K41 (= K122), S42 (≠ T123), T43 (= T124), R128 (≠ K208), A132 (≠ Q212), S134 (= S214), Q137 (≠ M217)
- binding tetrafluoroaluminate ion: S37 (= S118), G38 (= G119), K41 (= K122), Q81 (= Q161), S134 (= S214), G135 (= G215), G136 (= G216), E158 (= E238), H191 (= H271)
- binding magnesium ion: S42 (≠ T123), Q81 (= Q161)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
40% identity, 63% coverage: 94:303/333 of query aligns to 13:220/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (≠ A98), G38 (= G119), C39 (= C120), G40 (= G121), K41 (= K122), S42 (≠ T123), T43 (= T124), R128 (≠ K208), A132 (≠ Q212), S134 (= S214), Q137 (≠ M217)
- binding magnesium ion: S42 (≠ T123), Q81 (= Q161)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 63% coverage: 94:303/333 of query aligns to 14:221/371 of P68187
- A85 (≠ G164) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S185) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V193) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V196) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E198) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S203) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G216) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D237) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
40% identity, 63% coverage: 94:303/333 of query aligns to 11:218/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S118), G36 (= G119), C37 (= C120), G38 (= G121), K39 (= K122), S40 (≠ T123), T41 (= T124), R126 (≠ K208), A130 (≠ Q212), S132 (= S214), G134 (= G216), Q135 (≠ M217)
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
37% identity, 61% coverage: 94:296/333 of query aligns to 37:244/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ V96), S61 (= S118), G62 (= G119), G64 (= G121), K65 (= K122), S66 (≠ T123), T67 (= T124), Q111 (= Q161), K161 (≠ W211), Q162 (= Q212), S164 (= S214), G166 (= G216), M167 (= M217), Q188 (≠ E238), H221 (= H271)
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 58% coverage: 102:293/333 of query aligns to 36:226/378 of P69874
- F45 (= F111) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C120) mutation to T: Loss of ATPase activity and transport.
- L60 (= L126) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V142) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V200) mutation to M: Loss of ATPase activity and transport.
- D172 (= D237) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 64% coverage: 98:309/333 of query aligns to 19:229/393 of P9WQI3
- H193 (= H271) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 58% coverage: 94:287/333 of query aligns to 17:217/375 of 2d62A
8hplC Lpqy-sugabc in state 1 (see paper)
37% identity, 59% coverage: 91:286/333 of query aligns to 9:205/384 of 8hplC
8hprC Lpqy-sugabc in state 4 (see paper)
37% identity, 57% coverage: 98:286/333 of query aligns to 18:207/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S118), G39 (= G119), G41 (= G121), K42 (= K122), S43 (≠ T123), Q82 (= Q161), Q133 (= Q212), G136 (= G215), G137 (= G216), Q138 (≠ M217), H192 (= H271)
- binding magnesium ion: S43 (≠ T123), Q82 (= Q161)
Sites not aligning to the query:
Query Sequence
>3607963 FitnessBrowser__Dino:3607963
MLSREEIDGFDHSPEPPKPAPARAPKVTPSQPLAGEADLASRKGNWRYLAPEAAAPQADA
EAPAAAPEPTRATDAPATVISARDLDLVFQTNDGPVHALSGVNLEIGKGEFVSFIGPSGC
GKTTFLRAVAGLEHPTGGSLTVNGMTPDEARQARAYGYVFQAAGLYPWRTIAKNISLPLQ
IMGYSKADQEARVARVLELVELSGFAKKYPWQLSGGMQQRASIARALSFDADILLMDEPF
GALDEIVRDHLNEQLLALWKRTEKTIGFVTHSIPEAVYLSTKIVVMSPRPGRITDVIDSP
LPLDRPLDIRDTPEFIEIAHRVREGLRAGHLDE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory