SitesBLAST
Comparing 3607975 FitnessBrowser__Dino:3607975 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 77% coverage: 21:228/269 of query aligns to 16:226/378 of P69874
- C26 (≠ I31) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F32) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F51) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C60) mutation to T: Loss of ATPase activity and transport.
- L60 (= L66) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ W82) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V135) mutation to M: Loss of ATPase activity and transport.
- D172 (= D172) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
8w9mC Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
42% identity, 83% coverage: 28:250/269 of query aligns to 8:241/256 of 8w9mC
- binding adenosine-5'-triphosphate: F12 (= F32), Y20 (≠ V36), S42 (= S58), G43 (= G59), G45 (= G61), K46 (= K62), S47 (= S63), T48 (= T64), Q83 (= Q96), K132 (≠ A143), E136 (= E147), S138 (= S149), G140 (= G151), H195 (= H206)
- binding magnesium ion: S47 (= S63), Q83 (= Q96)
8wm7C Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
42% identity, 83% coverage: 28:250/269 of query aligns to 8:241/658 of 8wm7C
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
43% identity, 70% coverage: 34:221/269 of query aligns to 17:216/375 of 2d62A
1g291 Malk (see paper)
41% identity, 73% coverage: 25:221/269 of query aligns to 6:213/372 of 1g291
- binding magnesium ion: D69 (vs. gap), E71 (≠ D87), K72 (≠ T88), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S58), G39 (= G59), C40 (= C60), G41 (= G61), K42 (= K62), T43 (≠ S63), T44 (= T64)
Sites not aligning to the query:
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
37% identity, 85% coverage: 23:250/269 of query aligns to 5:242/257 of 8wm7D
8w9mD Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
37% identity, 85% coverage: 23:250/269 of query aligns to 3:240/256 of 8w9mD
- binding adenosine-5'-triphosphate: Y12 (≠ F32), H40 (≠ P57), S41 (= S58), G42 (= G59), G44 (= G61), K45 (= K62), S46 (= S63), T47 (= T64), Q82 (= Q96), Q135 (≠ E147), S137 (= S149), G139 (= G151), M140 (= M152), H194 (= H206)
- binding magnesium ion: S46 (= S63), Q82 (= Q96)
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 74% coverage: 23:221/269 of query aligns to 4:208/393 of P9WQI3
- H193 (= H206) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 69% coverage: 38:223/269 of query aligns to 16:207/384 of 8hplC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
36% identity, 75% coverage: 23:223/269 of query aligns to 3:209/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F32), S38 (= S58), C40 (= C60), G41 (= G61), K42 (= K62), S43 (= S63), T44 (= T64), Q82 (= Q96), R129 (≠ A143), Q133 (≠ E147), S135 (= S149), G136 (= G150), G137 (= G151), Q159 (≠ E173), H192 (= H206)
- binding magnesium ion: S43 (= S63), Q82 (= Q96)
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 69% coverage: 38:223/269 of query aligns to 18:209/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S58), G39 (= G59), G41 (= G61), K42 (= K62), S43 (= S63), Q82 (= Q96), Q133 (≠ E147), G136 (= G150), G137 (= G151), Q138 (≠ M152), H192 (= H206)
- binding magnesium ion: S43 (= S63), Q82 (= Q96)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
39% identity, 70% coverage: 34:221/269 of query aligns to 17:202/353 of 1vciA
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 76% coverage: 34:237/269 of query aligns to 14:218/369 of P19566
- L86 (= L100) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P174) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D179) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 77% coverage: 23:228/269 of query aligns to 3:211/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 77% coverage: 23:228/269 of query aligns to 3:211/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F32), S37 (= S58), G38 (= G59), C39 (= C60), G40 (= G61), K41 (= K62), S42 (= S63), T43 (= T64), Q81 (= Q96), R128 (≠ A143), A132 (≠ E147), S134 (= S149), G136 (= G151), Q137 (≠ M152), E158 (= E173), H191 (= H206)
- binding magnesium ion: S42 (= S63), Q81 (= Q96)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 77% coverage: 23:228/269 of query aligns to 3:211/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F32), G38 (= G59), C39 (= C60), G40 (= G61), K41 (= K62), S42 (= S63), T43 (= T64), R128 (≠ A143), S134 (= S149), Q137 (≠ M152)
- binding beryllium trifluoride ion: S37 (= S58), G38 (= G59), K41 (= K62), Q81 (= Q96), S134 (= S149), G136 (= G151), H191 (= H206)
- binding magnesium ion: S42 (= S63), Q81 (= Q96)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
36% identity, 77% coverage: 23:228/269 of query aligns to 3:211/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F32), V17 (≠ A38), G38 (= G59), C39 (= C60), G40 (= G61), K41 (= K62), S42 (= S63), T43 (= T64), R128 (≠ A143), A132 (≠ E147), S134 (= S149), Q137 (≠ M152)
- binding tetrafluoroaluminate ion: S37 (= S58), G38 (= G59), K41 (= K62), Q81 (= Q96), S134 (= S149), G135 (= G150), G136 (= G151), E158 (= E173), H191 (= H206)
- binding magnesium ion: S42 (= S63), Q81 (= Q96)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
36% identity, 77% coverage: 23:228/269 of query aligns to 3:211/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F32), V17 (≠ A38), G38 (= G59), C39 (= C60), G40 (= G61), K41 (= K62), S42 (= S63), T43 (= T64), R128 (≠ A143), A132 (≠ E147), S134 (= S149), Q137 (≠ M152)
- binding magnesium ion: S42 (= S63), Q81 (= Q96)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
36% identity, 77% coverage: 23:228/269 of query aligns to 4:212/371 of P68187
- A85 (≠ T99) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P120) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V128) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A131) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ K133) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ E138) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G151) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D172) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
36% identity, 77% coverage: 23:228/269 of query aligns to 1:209/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F32), S35 (= S58), G36 (= G59), C37 (= C60), G38 (= G61), K39 (= K62), S40 (= S63), T41 (= T64), R126 (≠ A143), A130 (≠ E147), S132 (= S149), G134 (= G151), Q135 (≠ M152)
Query Sequence
>3607975 FitnessBrowser__Dino:3607975
MKDAMTLATAAPLAPLDARPPVLTLSGVDKIFNGDVVALRDLSLTINQGDFMSLLGPSGC
GKSTALRIIADLLHPTRGSVDWTGQHDTGDLGVVFQEPTLMPWATVAQNTYLPYRLRGKP
YNAVKDEVLEALKLVGLEKFQNAYPRELSGGMKMRVSIARAMVTRPRLILMDEPFAALDE
ITRFKLNNDLLALKEKIGCTVIFVTHSVFESVFLSDRIVVMAARPGRVLREVQVDAPYPR
TETFRTSPEYAAHCRAASDALQEAIGAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory