Comparing 3607992 FitnessBrowser__Dino:3607992 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
45% identity, 92% coverage: 21:251/251 of query aligns to 7:239/240 of 1ji0A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 91% coverage: 23:250/251 of query aligns to 4:237/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 87% coverage: 21:239/251 of query aligns to 3:224/241 of 4u00A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
32% identity, 92% coverage: 19:250/251 of query aligns to 1:235/240 of 6mjpA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 92% coverage: 19:249/251 of query aligns to 1:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 92% coverage: 19:249/251 of query aligns to 1:234/234 of 4p31A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 92% coverage: 19:250/251 of query aligns to 1:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 92% coverage: 19:250/251 of query aligns to 1:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 92% coverage: 19:250/251 of query aligns to 1:235/235 of 6mhzA
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 89% coverage: 21:243/251 of query aligns to 4:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 89% coverage: 21:243/251 of query aligns to 4:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 89% coverage: 21:243/251 of query aligns to 4:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 89% coverage: 21:243/251 of query aligns to 4:230/242 of 2oljA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 92% coverage: 19:248/251 of query aligns to 1:233/233 of 6b8bA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 92% coverage: 19:250/251 of query aligns to 2:236/241 of 6mbnA
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
32% identity, 88% coverage: 11:230/251 of query aligns to 1:231/257 of P0AAH0
4q4aA Improved model of amp-pnp bound tm287/288 (see paper)
30% identity, 97% coverage: 1:243/251 of query aligns to 313:562/572 of 4q4aA
Sites not aligning to the query:
6quzA Structure of atpgs-bound outward-facing tm287/288 in complex with sybody sb_tm35 (see paper)
30% identity, 97% coverage: 1:243/251 of query aligns to 309:558/568 of 6quzA
6qv0A Structure of atp-bound outward-facing tm287/288 in complex with sybody sb_tm35 (see paper)
30% identity, 97% coverage: 1:243/251 of query aligns to 309:558/568 of 6qv0A
7zdaC If(apo/asym) conformation of cyddc in adp+pi(cydc)/atp(cydd) bound state (dataset-2) (see paper)
33% identity, 87% coverage: 21:239/251 of query aligns to 339:560/572 of 7zdaC
Sites not aligning to the query:
>3607992 FitnessBrowser__Dino:3607992
MNVKPDFSKGISHAETAPAFLSVWDLHAYYGESYIVQGISFNVHEGEILALLGRNGAGKT
TTLRAIARLGDPQVRHGEIWLDHARLHEMESHEAAVAGLGLVPEDRRIIPGLTVEENLQL
AQIVEPKGWSLDRLYDLFPRLGERRKQEGVTLSGGEQQMLSIARALARDLKVLLLDEPYE
GLAPVIVDEIEKTLRVIKEQGMTTVIVEQNAVRALELADRAVILDTGSIVFDGAAAEVLE
NAELRAEYLAI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory