Comparing 3607993 FitnessBrowser__Dino:3607993 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
34% identity, 99% coverage: 1:249/252 of query aligns to 2:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 98% coverage: 1:248/252 of query aligns to 2:253/253 of 1g9xB
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
29% identity, 98% coverage: 3:248/252 of query aligns to 2:240/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
29% identity, 98% coverage: 3:248/252 of query aligns to 4:242/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
29% identity, 98% coverage: 3:248/252 of query aligns to 4:242/263 of 7d08B
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 98% coverage: 2:249/252 of query aligns to 1:236/240 of 6mjpA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 94% coverage: 16:252/252 of query aligns to 18:246/343 of P30750
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 93% coverage: 6:240/252 of query aligns to 6:232/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 93% coverage: 6:240/252 of query aligns to 6:232/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 93% coverage: 6:240/252 of query aligns to 6:232/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 93% coverage: 6:240/252 of query aligns to 6:232/353 of Q97UY8
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 92% coverage: 6:236/252 of query aligns to 4:223/240 of 4ymuJ
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 94% coverage: 16:252/252 of query aligns to 19:247/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 94% coverage: 16:252/252 of query aligns to 19:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 94% coverage: 16:252/252 of query aligns to 19:247/344 of 3tuiC
Sites not aligning to the query:
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
26% identity, 98% coverage: 3:248/252 of query aligns to 6:238/240 of 1ji0A
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 90% coverage: 3:230/252 of query aligns to 4:222/501 of P04983
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 95% coverage: 3:241/252 of query aligns to 3:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 95% coverage: 3:241/252 of query aligns to 3:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 95% coverage: 3:241/252 of query aligns to 3:230/242 of 2olkA
>3607993 FitnessBrowser__Dino:3607993
MGILEVKGVGKRFGGLQALGDVNLSIKENSVHAIIGPNGAGKSTLLNCLVGKLIPDTGSV
MFDGQSVLGRSPHEICQMGISRVFQTPEIFGDLTVMENVLIACFAKRDGSFELNAITSVR
SQSDMRDMAETILRDVNMLDKHAMHAASLSRGDKRRLEMAMCLVQQPRMLLLDEPTAGMA
RADTNNTIDLLKEIRDTRDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDSPENIKGHP
KVREAYLGETAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory