Comparing 3608020 FitnessBrowser__Dino:3608020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
B3EY95 Succinyl-CoA:acetate CoA-transferase; Succinyl-coenzyme A (CoA):acetate CoA-transferase; SCACT; EC 2.8.3.18 from Acetobacter aceti (see paper)
28% identity, 25% coverage: 377:503/515 of query aligns to 358:493/505 of B3EY95
Sites not aligning to the query:
4eu6A Succinyl-coa:acetate coa-transferase (aarch6) in complex with coa, acetate, and covalent acetylglutamyl anhydride and glutamyl-coa thioester adducts (see paper)
28% identity, 25% coverage: 377:503/515 of query aligns to 357:492/513 of 4eu6A
Sites not aligning to the query:
4eu5A Succinyl-coa:acetate coa-transferase (aarch6) in complex with coa (see paper)
28% identity, 25% coverage: 377:503/515 of query aligns to 357:492/513 of 4eu5A
Sites not aligning to the query:
4eu3B Succinyl-coa:acetate coa-transferase (aarch6) in complex with citrate (subunit b) or unliganded (subunit a) (see paper)
28% identity, 25% coverage: 377:503/515 of query aligns to 357:492/504 of 4eu3B
Sites not aligning to the query:
5dw5A Succinyl-coa:acetate coa-transferase (aarch6) bound to the coa analogue 3'-phosphoadenosine 5'-(o-(n-propylpantothenamide)) pyrophosphate (mx) (see paper)
28% identity, 25% coverage: 377:503/515 of query aligns to 356:491/512 of 5dw5A
Sites not aligning to the query:
4eucA Succinyl-coa:acetate coa-transferase (aarch6-e294a) in complex with dethiaacetyl-coa (see paper)
28% identity, 25% coverage: 377:503/515 of query aligns to 357:492/504 of 4eucA
Sites not aligning to the query:
>3608020 FitnessBrowser__Dino:3608020
MRGVSVTPQGSILDTARWPAGAAPVTTPLGLLLPVGNPAPALSVLPPRADAGDGRKLRPG
LEVVFDELGIADGRTLSFHHHYRDGDRVVVEVMRLARERGLKGLTICPSSIFPTHSSLVP
LLEDGTITSIVTDYMRGPVADWITAHPGRVTVLLQSHGGRARAISSGQLKIDVAFVGASL
ADRRGNLTGRAGALACGPLGYPAVDAQYAKATVGMAHDVTDAALPRVDIPARFVDLVVPF
ERPGDANRIRSGSTVPSETPLSRGIAERSSDIIAAAGLLTEEFALQSGAGGYSLAAVPHV
GSLLAAQGMRGAFMSGGITSAHVELLRAGVFRAIRDVQCFDLEAVRSAIENPDHQMMTAA
EYASPLHPNPCVDDLSVMLLGAVEVDFGFNVNVVSGTDGRILGGPGGHPDAARGADLSIV
LTSLTGGGFAKIVPAVRCVSTPGVDVDVVVTEAGFAINPARADLVARLTRAGLKPVEIED
LARIAGAQAAHSPAPLAERPSVHIERRDGLILDWV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory