SitesBLAST
Comparing 3608022 FitnessBrowser__Dino:3608022 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6b9uA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh
49% identity, 96% coverage: 10:256/256 of query aligns to 2:244/244 of 6b9uA
- active site: G15 (= G23), S142 (= S146), L152 (= L156), Y155 (= Y159), K159 (= K163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G19), S14 (= S22), G15 (= G23), F16 (= F24), D35 (= D43), R36 (≠ L44), A57 (≠ C65), D58 (= D66), I59 (≠ V67), N85 (= N93), A86 (= A94), V140 (= V144), S142 (= S146), Y155 (= Y159), K159 (= K163), A187 (≠ M191), G188 (= G192), T190 (= T194), P191 (= P195), L192 (= L196), F196 (= F200)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 96% coverage: 9:253/256 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G23), N111 (= N118), S139 (= S146), Q149 (≠ L156), Y152 (= Y159), K156 (= K163)
- binding acetoacetyl-coenzyme a: D93 (≠ N100), K98 (≠ D105), S139 (= S146), N146 (≠ R153), V147 (≠ P154), Q149 (≠ L156), Y152 (= Y159), F184 (≠ L196), M189 (= M201), K200 (= K212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), N17 (≠ S22), G18 (= G23), I19 (≠ F24), D38 (= D43), F39 (≠ L44), V59 (≠ C65), D60 (= D66), V61 (= V67), N87 (= N93), A88 (= A94), G89 (= G95), I90 (≠ W96), T137 (≠ V144), S139 (= S146), Y152 (= Y159), K156 (= K163), P182 (= P189), F184 (≠ L196), T185 (≠ L197), T187 (= T199), M189 (= M201)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
36% identity, 96% coverage: 10:255/256 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G23), S142 (= S146), Y155 (= Y159), K159 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), S15 (= S22), G16 (= G23), I17 (≠ F24), D36 (= D43), I37 (≠ L44), A61 (≠ C65), D62 (= D66), T63 (≠ V67), N89 (= N93), A90 (= A94), M140 (≠ V144), S142 (= S146), Y155 (= Y159), K159 (= K163), P185 (= P189), A186 (≠ V190), Y187 (≠ M191), I188 (≠ G192), L192 (= L196)
1ahiA 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid (see paper)
38% identity, 96% coverage: 9:253/256 of query aligns to 8:249/255 of 1ahiA
- active site: G22 (= G23), S146 (= S146), M156 (≠ L156), Y159 (= Y159), K163 (= K163)
- binding glycochenodeoxycholic acid: S146 (= S146), A148 (= A148), N151 (≠ R151), Y159 (= Y159), A196 (≠ L196), V200 (≠ F200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G18 (= G19), A21 (≠ S22), G22 (= G23), I23 (≠ F24), D42 (= D43), I43 (≠ L44), D68 (= D66), I69 (≠ V67), N95 (= N93), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (≠ V190), I192 (≠ G192), T194 (= T194), A196 (≠ L196)
Sites not aligning to the query:
P0AET8 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.159 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 96% coverage: 9:253/256 of query aligns to 8:249/255 of P0AET8
- I23 (≠ F24) binding
- DI 42:43 (≠ DL 43:44) binding
- DI 68:69 (≠ DV 66:67) binding
- N95 (= N93) binding
- G99 (≠ S97) binding
- S146 (= S146) binding ; mutation S->A,H: Reduction of the catalytic efficiency by over 65%. No effect on the affinity for cholate and NAD.
- N151 (≠ R151) binding
- Y159 (= Y159) binding ; binding ; mutation to F: Loss of activity.; mutation to H: Reduction of the catalytic efficiency by 87.7%. No effect on the affinity for cholate and NAD.
- K163 (= K163) binding ; mutation to I: Reduction of the catalytic efficiency by 95%. No effect on the affinity for cholate and NAD.; mutation to R: Reduction of the catalytic efficiency by 35%. No effect on the affinity for cholate and NAD.
- ILT 192:194 (≠ GAT 192:194) binding
1ahhA 7 alpha-hydroxysteroid dehydrogenase complexed with NAD+ (see paper)
38% identity, 96% coverage: 9:253/256 of query aligns to 8:249/253 of 1ahhA
- active site: G22 (= G23), S146 (= S146), M156 (≠ L156), Y159 (= Y159), K163 (= K163)
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), A21 (≠ S22), D42 (= D43), I43 (≠ L44), C67 (= C65), D68 (= D66), I69 (≠ V67), N95 (= N93), G97 (= G95), T145 (≠ G145), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (≠ V190), I192 (≠ G192)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
38% identity, 97% coverage: 5:253/256 of query aligns to 3:249/258 of 4wecA
- active site: G21 (= G23), S143 (= S146), Q154 (≠ S157), Y157 (= Y159), K161 (= K163)
- binding nicotinamide-adenine-dinucleotide: G17 (= G19), A19 (= A21), S20 (= S22), G21 (= G23), I22 (≠ F24), D41 (= D43), I42 (≠ L44), V61 (≠ C65), D62 (= D66), V63 (= V67), N89 (= N93), T141 (≠ V144), Y157 (= Y159), K161 (= K163), P187 (= P189), P189 (≠ M191), V190 (≠ G192)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
40% identity, 96% coverage: 10:255/256 of query aligns to 3:237/240 of 2d1yA
- active site: G16 (= G23), S135 (= S146), N145 (≠ L156), Y148 (= Y159), K152 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), R15 (≠ S22), I17 (≠ F24), D36 (= D43), L37 (= L44), R38 (≠ N45), V55 (= V63), D56 (= D66), L57 (≠ V67), N83 (= N93), A84 (= A94), A85 (≠ G95), I86 (≠ W96), V133 (= V144), S135 (= S146), Y148 (= Y159), K152 (= K163), P178 (= P189), G179 (≠ V190), I181 (≠ G192), T183 (= T194), A185 (≠ L196), V186 (≠ L197)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
40% identity, 95% coverage: 10:253/256 of query aligns to 5:254/258 of 3ak4A
- active site: G18 (= G23), S141 (= S146), L151 (= L156), Y154 (= Y159), K158 (= K163), E199 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S22), G18 (= G23), I19 (≠ F24), D38 (= D43), L39 (= L44), V60 (≠ C65), D61 (= D66), V62 (= V67), N88 (= N93), A89 (= A94), G90 (= G95), T139 (≠ V144), S141 (= S146), Y154 (= Y159), K158 (= K163), G185 (≠ V190), V187 (≠ G192), T189 (= T194), M191 (≠ L196)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
40% identity, 96% coverage: 7:253/256 of query aligns to 2:245/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
36% identity, 95% coverage: 13:255/256 of query aligns to 3:248/250 of 2cfcA
- active site: G13 (= G23), S142 (= S146), Y155 (= Y159), K159 (= K163)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ R153), R152 (≠ L156), Y155 (= Y159), W195 (≠ T199), R196 (≠ F200)
- binding nicotinamide-adenine-dinucleotide: G9 (= G19), S12 (= S22), G13 (= G23), N14 (≠ F24), D33 (= D43), L34 (= L44), A59 (≠ C65), D60 (= D66), V61 (= V67), N87 (= N93), A88 (= A94), G89 (= G95), I140 (≠ V144), P185 (= P189), G186 (≠ V190), M187 (= M191), I188 (≠ G192), T190 (= T194), P191 (= P195), M192 (≠ L196), T193 (≠ L197)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
36% identity, 95% coverage: 13:255/256 of query aligns to 3:248/250 of Q56840
- SGN 12:14 (≠ SGF 22:24) binding
- D33 (= D43) binding
- DV 60:61 (= DV 66:67) binding
- N87 (= N93) binding
- S142 (= S146) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ L156) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y159) mutation Y->E,F: Loss of activity.
- K159 (= K163) mutation to A: Loss of activity.
- R179 (= R183) mutation to A: Loss of activity.
- IETPM 188:192 (≠ GATPL 192:196) binding
- WR 195:196 (≠ TF 199:200) binding
- R196 (≠ F200) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (= R210) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ T216) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
38% identity, 96% coverage: 9:253/256 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G19), S20 (≠ A21), K21 (≠ S22), G22 (= G23), I23 (≠ F24), A43 (≠ L44), S44 (≠ N45), S45 (≠ G46), G68 (≠ C65), D69 (= D66), V70 (= V67), N96 (= N93), S97 (≠ A94), G98 (= G95), Y100 (≠ H98), I144 (≠ V144), S146 (= S146), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (≠ V190), M191 (= M191), I192 (≠ G192), T194 (= T194), G196 (≠ L196), T197 (≠ L197)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S146), Y159 (= Y159), M191 (= M191), I202 (≠ G202)
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
41% identity, 96% coverage: 8:253/256 of query aligns to 1:243/247 of 2ewmB
- active site: G16 (= G23), S139 (= S146), Y149 (≠ L156), Y152 (= Y159), K156 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), N15 (≠ S22), G16 (= G23), I17 (≠ F24), D36 (= D43), L37 (= L44), C59 (= C65), D60 (= D66), V61 (= V67), N87 (= N93), S139 (= S146), Y152 (= Y159), K156 (= K163), P182 (= P189), S183 (vs. gap), L184 (vs. gap), V185 (= V190), T189 (= T194)
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
40% identity, 96% coverage: 10:255/256 of query aligns to 4:243/253 of 7xqmB
- binding s-adenosyl-l-homocysteine: G13 (= G19), I16 (≠ S22), D34 (= D43), L35 (= L44), R36 (≠ N45), V53 (= V63), L55 (≠ V67), N81 (= N93), A82 (= A94), A83 (≠ G95), Y146 (= Y159)
8hsaA Brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation/m196i/i258m/k262t-NAD+
38% identity, 96% coverage: 9:253/256 of query aligns to 4:245/248 of 8hsaA
- binding nicotinamide-adenine-dinucleotide: G14 (= G19), I19 (≠ F24), D38 (= D43), L39 (= L44), C63 (= C65), N64 (≠ D66), V65 (= V67), N91 (= N93), A92 (= A94), G93 (= G95), I140 (≠ V144), S141 (≠ G145), Y155 (= Y159), K159 (= K163), P185 (= P189), G186 (≠ V190)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
41% identity, 99% coverage: 3:256/256 of query aligns to 2:253/254 of 3lqfA
- active site: G22 (= G23), S144 (= S146), Y159 (= Y159), K163 (= K163)
- binding meso-erythritol: N151 (≠ P152), Y159 (= Y159), Y191 (≠ M191), T197 (≠ F200), M200 (= M203)
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), S21 (= S22), G22 (= G23), I23 (≠ F24), D42 (= D43), R43 (≠ L44), D66 (= D72), V67 (= V73), S92 (≠ N93), L142 (≠ V144), S144 (= S146), K163 (= K163), P189 (= P189), V192 (≠ G192), T194 (= T194), M196 (≠ T199), T197 (≠ F200)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
41% identity, 99% coverage: 3:256/256 of query aligns to 2:253/254 of 2wsbA
- active site: G22 (= G23), S144 (= S146), Y159 (= Y159), K163 (= K163)
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), S21 (= S22), G22 (= G23), I23 (≠ F24), D42 (= D43), R43 (≠ L44), D66 (= D72), V67 (= V73), S92 (≠ N93), A93 (= A94), L142 (≠ V144), S144 (= S146), Y159 (= Y159), K163 (= K163), P189 (= P189), V192 (≠ G192), T194 (= T194), M196 (≠ T199), T197 (≠ F200)
- binding n-propanol: S144 (= S146), M145 (≠ T147), N151 (≠ P152), N151 (≠ P152), Y159 (= Y159), Y159 (= Y159), Y191 (≠ M191)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
41% identity, 99% coverage: 3:256/256 of query aligns to 2:253/254 of 2wdzA
- active site: G22 (= G23), S144 (= S146), Y159 (= Y159), K163 (= K163)
- binding (2S)-pentane-1,2-diol: A45 (= A49), D49 (≠ A53), R62 (≠ D66), S146 (≠ A148), Y159 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), S21 (= S22), G22 (= G23), I23 (≠ F24), D42 (= D43), R43 (≠ L44), A65 (= A71), D66 (= D72), V67 (= V73), S92 (≠ N93), A93 (= A94), L142 (≠ V144), S144 (= S146), Y159 (= Y159), K163 (= K163), P189 (= P189), V192 (≠ G192), T194 (= T194), M196 (≠ T199), T197 (≠ F200)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
41% identity, 99% coverage: 3:256/256 of query aligns to 2:253/254 of C0KTJ6
Sites not aligning to the query:
Query Sequence
>3608022 FitnessBrowser__Dino:3608022
MTETNTSRRLSGKTAIVTGAASGFGREIARRFVREGARVAIVDLNGEGAKAVADALQQNA
IAVTCDVSKGADVSRAVQETIDAFGRVDIAINNAGWSHRNQPALDVDFETFKRVYEVNVD
SIFHATHALVPHWRDIGGGVMINVGSTAGIRPRPGLSWYNSSKGAVNMMTKTLAVELAPD
RVRVCGLAPVMGATPLLETFMGMPDTPENRAKFLGTIPLGRLCEPEDMANAALYLASDEA
NFITGVILEVDGGRTV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory