Comparing 3608030 FitnessBrowser__Dino:3608030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
54% identity, 75% coverage: 7:268/351 of query aligns to 3:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
54% identity, 75% coverage: 7:268/351 of query aligns to 3:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
53% identity, 74% coverage: 7:264/351 of query aligns to 3:259/260 of 7ahdC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
42% identity, 66% coverage: 37:269/351 of query aligns to 12:244/375 of 2d62A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 65% coverage: 49:276/351 of query aligns to 23:249/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 65% coverage: 49:276/351 of query aligns to 24:250/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 65% coverage: 49:276/351 of query aligns to 24:250/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 65% coverage: 49:276/351 of query aligns to 24:250/344 of 3tuiC
Sites not aligning to the query:
1g291 Malk (see paper)
40% identity, 68% coverage: 31:269/351 of query aligns to 3:241/372 of 1g291
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 66% coverage: 41:272/351 of query aligns to 27:252/378 of P69874
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
40% identity, 65% coverage: 41:269/351 of query aligns to 16:230/353 of 1vciA
8hplC Lpqy-sugabc in state 1 (see paper)
39% identity, 63% coverage: 47:268/351 of query aligns to 17:232/384 of 8hplC
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 64% coverage: 46:268/351 of query aligns to 18:234/363 of 8hprC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 64% coverage: 46:268/351 of query aligns to 18:234/362 of 8hprD
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 67% coverage: 36:271/351 of query aligns to 6:239/240 of 4ymuJ
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 64% coverage: 45:268/351 of query aligns to 18:235/393 of P9WQI3
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 70% coverage: 24:269/351 of query aligns to 1:235/369 of P19566
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
38% identity, 63% coverage: 49:270/351 of query aligns to 20:240/253 of 6z5uK
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
38% identity, 63% coverage: 49:270/351 of query aligns to 22:242/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
38% identity, 63% coverage: 49:270/351 of query aligns to 22:242/263 of 7d08B
Sites not aligning to the query:
>3608030 FitnessBrowser__Dino:3608030
MHGDTVIEISNVWKIFGANAQAALEAVRDRGLSKAEILAEFNAVVGVADVSLSVRRGEIF
CIMGLSGSGKSTLVRHFNRLLEPTAGRIEIEGTDVMALGTQELQRFRNRQIGMVFQNFAL
MPHRSVLDNVAMPLEIRKVPKNERMRQAAAILDIVELGAWGAKFAHELPGGMQQRVGLAR
ALAANPDVLLMDEPFSALDPLIRRQLQDEFIRLSKILKKTTIFITHDLDEAVRIGDRIAI
MRDGKVVQMGTAEDIVMHPADDYVADFVAGISRLKVVHAHAVMQPLEAYLATHGPLPAAV
PKVDEGETLSNLITLAIDDENPILVQDAGRDVGIITRADLLRTVIEGTEVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory