Comparing 3608039 FitnessBrowser__Dino:3608039 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
38% identity, 97% coverage: 4:435/444 of query aligns to 14:445/449 of 5lh9D
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
38% identity, 97% coverage: 4:435/444 of query aligns to 12:443/447 of 5lhaA
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
38% identity, 95% coverage: 17:439/444 of query aligns to 35:447/448 of 6io1B
Sites not aligning to the query:
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 98% coverage: 4:436/444 of query aligns to 23:454/460 of 5kr6B
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
35% identity, 94% coverage: 19:435/444 of query aligns to 33:435/443 of 6fyqA
Sites not aligning to the query:
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 98% coverage: 4:437/444 of query aligns to 19:451/455 of 5kr5A
6s54A Transaminase from pseudomonas fluorescens (see paper)
34% identity, 95% coverage: 12:435/444 of query aligns to 29:448/453 of 6s54A
Sites not aligning to the query:
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
35% identity, 94% coverage: 21:438/444 of query aligns to 37:445/450 of 6gwiB
Sites not aligning to the query:
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 96% coverage: 8:435/444 of query aligns to 64:488/504 of Q94CE5
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
33% identity, 94% coverage: 19:437/444 of query aligns to 39:452/458 of 5kr3A
5ghgB Transaminase w58l with smba
34% identity, 98% coverage: 8:441/444 of query aligns to 21:430/433 of 5ghgB
Sites not aligning to the query:
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
32% identity, 99% coverage: 1:440/444 of query aligns to 24:458/458 of 3gjuA
Sites not aligning to the query:
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
32% identity, 96% coverage: 1:428/444 of query aligns to 23:446/458 of 3fcrA
Sites not aligning to the query:
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 94% coverage: 20:437/444 of query aligns to 39:453/459 of 5kquC
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
33% identity, 95% coverage: 19:438/444 of query aligns to 34:436/438 of 6zhkA
Sites not aligning to the query:
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
33% identity, 96% coverage: 19:444/444 of query aligns to 34:450/453 of 6s4gA
Sites not aligning to the query:
7q9xAAA Probable aminotransferase
33% identity, 96% coverage: 19:444/444 of query aligns to 35:451/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
33% identity, 96% coverage: 19:444/444 of query aligns to 35:451/455 of 4a6tC
Sites not aligning to the query:
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
33% identity, 96% coverage: 19:444/444 of query aligns to 7:423/427 of 4ba5A
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
33% identity, 96% coverage: 19:444/444 of query aligns to 6:419/423 of 4a6rA
>3608039 FitnessBrowser__Dino:3608039
MAGHVFGRSAAQMPTAVAGAGCYIIDADGKRYLDGSGGAAVSCLGHDHPAVRAALHAQID
KIAFAHTGFFTSEPAEVLCDALIAAAPKGIEKVYLLSGGSESVEAALKLARQFFLETGEP
RRHRVIARRQSYHGNTLGALAAGGNAWRREKYAPLLVETYHIDPCYAYRHQAVGESDAAY
GRRAADALRTEIERLGPETVMAFIAEPVVGATAGAVPPAPGYFERIREICDEYGVLLILD
EVMCGMGRTGTLFACEQDGISPDIVTIAKGLGAGYAPIGAMLASGRIYDAIAQGSGSFQH
GHTYHGHPLAAAAAGAVVETLRAPGTMAQVRAKGATLQSRLEAALGQHSHVGDIRGRGLF
RGIELVEDRDTKRPLDPARKVSARIKAAAMARGLICYPGSGTIDGKHGDHILLAPPFIIE
DKQIDALVHMLAEAIDDAMAATQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory