Comparing 3608061 FitnessBrowser__Dino:3608061 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 99% coverage: 4:367/368 of query aligns to 1:365/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
44% identity, 98% coverage: 7:367/368 of query aligns to 2:363/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 98% coverage: 7:367/368 of query aligns to 2:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
38% identity, 98% coverage: 7:367/368 of query aligns to 2:321/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
32% identity, 63% coverage: 8:240/368 of query aligns to 1:219/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
32% identity, 70% coverage: 2:258/368 of query aligns to 7:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
31% identity, 70% coverage: 2:258/368 of query aligns to 7:234/236 of 7f5xA
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
24% identity, 68% coverage: 10:259/368 of query aligns to 3:252/253 of 7n9dA
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
23% identity, 68% coverage: 10:261/368 of query aligns to 4:257/260 of 7lntB
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
23% identity, 68% coverage: 10:261/368 of query aligns to 5:258/261 of 7lnuB
3wwmA Crystal structure of lysz from thermus thermophilus with adp (see paper)
31% identity, 36% coverage: 121:252/368 of query aligns to 139:263/269 of 3wwmA
Sites not aligning to the query:
O50147 [LysW]-aminoadipate kinase; EC 2.7.2.17 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
31% identity, 36% coverage: 121:252/368 of query aligns to 139:263/269 of O50147
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
33% identity, 21% coverage: 154:230/368 of query aligns to 123:203/219 of 2ji5A
Sites not aligning to the query:
7lnuA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
25% identity, 53% coverage: 10:205/368 of query aligns to 4:200/239 of 7lnuA
>3608061 FitnessBrowser__Dino:3608061
MATLSAARCLVVKIGSALLVDQASGALRQDWLTGLAQDVAEIRARGADVILVSSGSIALG
RRVLGLGTGALPLEQAQAAAAVGQIRLARAYEEVLAPHKITTAQVLVTLEDSTDRRRYLN
TRATLGTLLSLGVTPIVNENDTIATDEIRYGDNDRLAAQVAVMAGADQLVLLSDVDGLYT
ANPATDPTATRFDRVDEITPEIEAMAGDAVSGLSKGGMKTKLMAARTAMDAGCAMAITEG
ARPRPLKALMDGAPATWFVPRTDPLAARKHWIAAMKPRGEITVDAGACAALKRGKSLLPA
GITEVSGAFGRGDPVIILAPDGTALGRGLTRYTAVEARAIRGHRSAEIEAVLGYPGRAVL
IHRDDMVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory