Comparing 3608063 FitnessBrowser__Dino:3608063 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
38% identity, 93% coverage: 26:415/421 of query aligns to 18:406/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
38% identity, 93% coverage: 26:415/421 of query aligns to 18:406/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
32% identity, 95% coverage: 13:413/421 of query aligns to 10:407/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
23% identity, 65% coverage: 116:390/421 of query aligns to 105:414/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
23% identity, 65% coverage: 116:390/421 of query aligns to 104:413/455 of 5j7iC
8cekA Succinyl-coa reductase from clostridium kluyveri (sucd) with NADPH (see paper)
24% identity, 64% coverage: 117:385/421 of query aligns to 94:400/449 of 8cekA
Sites not aligning to the query:
8cejC Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
24% identity, 64% coverage: 117:385/421 of query aligns to 94:400/449 of 8cejC
Sites not aligning to the query:
8cejA Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
24% identity, 64% coverage: 117:385/421 of query aligns to 94:400/449 of 8cejA
Sites not aligning to the query:
>3608063 FitnessBrowser__Dino:3608063
MKDFADIPALMAEIGTAAKAAAAELAFAPADQRAQALTAAADAVWARRDEIIAANARDLD
YGRDKGLSPAMMDRLALDEARIQGIVDGLRAVAAQDDPVGAVLSEWDRPTGLHIRRVRTP
LGVIGVIYESRPNVTADAGALCLKSGNAVILRGGSESFHSSSLIHACLRDGLRAADLPET
AIQLVPTRDRAAVGEMLTMTDTIDVIIPRGGKGLVGRVQAEARVPVFAHLEGICHIYVDA
DADPDKTARVILNAKTRRTGICGAAECLLVDRAWYDRNGATFIADLIAAGVEVRADDTLQ
AIPGTVPAKADDFGREFLDMIIAARVVDGVDGAIAHIRRYGSQHTDCILTENDATAARFF
QRLDSAILMRNASTQFADGGEFGMGAEIGIATGKMHARGPVGAEQLTSFKYLVEGDGTIR
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory