SitesBLAST
Comparing 3608080 FitnessBrowser__Dino:3608080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
39% identity, 100% coverage: 2:803/804 of query aligns to 40:849/857 of Q63342
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
39% identity, 100% coverage: 2:803/804 of query aligns to 3:812/824 of 4pabB
- active site: T53 (≠ H52), E102 (≠ M101), H226 (= H225), Y255 (= Y254), E536 (≠ D530)
- binding flavin-adenine dinucleotide: I11 (= I10), G12 (= G11), G14 (= G13), C15 (≠ V14), V16 (= V15), L35 (= L34), E36 (= E35), K37 (≠ R36), G43 (= G42), S44 (= S43), T45 (= T44), H47 (= H46), A48 (= A47), A49 (= A48), G50 (= G49), L51 (≠ G50), V175 (= V174), A204 (≠ G203), G205 (= G204), W207 (= W206), H226 (= H225), Y228 (= Y227), G326 (= G320), I328 (≠ F322), F353 (≠ V347), Y355 (≠ A349), G356 (= G350), I357 (≠ F351), I358 (≠ S352)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ L517), E536 (≠ D530), T538 (= T532), I550 (≠ T544), F612 (= F603), L613 (≠ F604), Y632 (= Y623), E639 (= E630), F680 (= F671), Y700 (≠ R691)
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
38% identity, 100% coverage: 2:803/804 of query aligns to 47:856/866 of Q9UI17
- CV 59:60 (≠ VV 14:15) binding
- EK 80:81 (≠ ER 35:36) binding
- 87:95 (vs. 42:50, 89% identical) binding
- H91 (= H46) modified: Tele-8alpha-FAD histidine
- H109 (≠ Q64) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V174) binding
- S279 (≠ P234) to P: in dbSNP:rs532964
- FGYGII 397:402 (≠ VMAGFS 347:352) binding
- A530 (≠ G480) to G: in dbSNP:rs1805073
- S646 (≠ R593) to P: in dbSNP:rs1805074
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
30% identity, 100% coverage: 1:804/804 of query aligns to 22:824/824 of Q8GAI3
- W66 (= W45) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H46) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
28% identity, 100% coverage: 1:804/804 of query aligns to 1:830/830 of Q9AGP8
- IV 14:15 (≠ VV 14:15) binding
- DQ 35:36 (≠ ER 35:36) binding
- STSH 45:48 (≠ STWH 43:46) binding
- L52 (≠ G50) binding
- V174 (= V174) binding
- H225 (= H225) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (= Y254) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VW--VT 360:363 (≠ VMAGFS 347:352) binding
- Y539 (≠ L517) binding
- D552 (= D530) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
27% identity, 100% coverage: 3:804/804 of query aligns to 1:828/828 of 1pj6A
- active site: H223 (= H225), Y257 (= Y254), D550 (= D530)
- binding flavin-adenine dinucleotide: G9 (= G11), G11 (= G13), I12 (≠ V14), V13 (= V15), D33 (≠ E35), Q34 (≠ R36), G42 (= G42), S43 (= S43), T44 (= T44), H46 (= H46), P48 (≠ A48), L50 (≠ G50), V172 (= V174), A201 (≠ G203), G202 (= G204), W204 (= W206), H223 (= H225), Y257 (= Y254), G331 (= G320), I332 (≠ P321), V358 (= V347), W359 (≠ M348), V360 (≠ A349), T361 (≠ S352)
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
27% identity, 99% coverage: 6:804/804 of query aligns to 3:827/827 of 1pj7A
- active site: H222 (= H225), Y256 (= Y254), D549 (= D530)
- binding flavin-adenine dinucleotide: G8 (= G11), G10 (= G13), I11 (≠ V14), V12 (= V15), D32 (≠ E35), Q33 (≠ R36), G41 (= G42), S42 (= S43), T43 (= T44), H45 (= H46), P47 (≠ A48), L49 (≠ G50), T170 (≠ M173), V171 (= V174), A200 (≠ G203), G201 (= G204), W203 (= W206), H222 (= H225), Y256 (= Y254), I331 (≠ P321), V357 (= V347), W358 (≠ M348), V359 (≠ A349), T360 (≠ S352)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (≠ F487), Y536 (≠ L517), D549 (= D530), T551 (= T532), G563 (≠ T544), F629 (= F604), Y648 (= Y623), E655 (= E630), Y696 (≠ F671)
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
27% identity, 99% coverage: 6:804/804 of query aligns to 3:827/827 of 3gsiA
- active site: H222 (= H225), Y256 (= Y254), A549 (≠ D530)
- binding flavin-adenine dinucleotide: G10 (= G13), I11 (≠ V14), V12 (= V15), D32 (≠ E35), Q33 (≠ R36), G41 (= G42), S42 (= S43), T43 (= T44), H45 (= H46), P47 (≠ A48), L49 (≠ G50), T170 (≠ M173), V171 (= V174), A200 (≠ G203), G201 (= G204), W203 (= W206), H222 (= H225), Y256 (= Y254), G330 (= G320), I331 (≠ P321), F332 (= F322), V357 (= V347), W358 (≠ M348), V359 (≠ A349), T360 (≠ S352)
- binding magnesium ion: D254 (≠ E252), V409 (≠ Q400)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (≠ F487), Y536 (≠ L517), T551 (= T532), G563 (≠ T544), F629 (= F604), Y648 (= Y623), E655 (= E630), Y696 (≠ F671)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
25% identity, 45% coverage: 21:384/804 of query aligns to 21:370/374 of 1y56B
- active site: F44 (≠ W45), G47 (≠ A48), T48 (≠ G49), H224 (= H225), P239 (= P244), G305 (= G320), M338 (≠ S352)
- binding flavin-adenine dinucleotide: I33 (≠ L34), E34 (= E35), K35 (≠ R36), S42 (= S43), T43 (= T44), R45 (≠ H46), C46 (≠ A47), G47 (≠ A48), G49 (= G50), E170 (≠ M173), V171 (= V174), T200 (≠ G203), N201 (≠ G204), W203 (= W206), G305 (= G320), Y306 (≠ P321), Y307 (≠ F322), G334 (≠ A349), H335 (vs. gap), G336 (= G350), F337 (= F351), M338 (≠ S352)
- binding flavin mononucleotide: F44 (≠ W45), R45 (≠ H46), I260 (≠ C271), R301 (≠ S316), W303 (≠ I318)
Sites not aligning to the query:
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
26% identity, 38% coverage: 465:769/804 of query aligns to 29:330/362 of 1worA
Sites not aligning to the query:
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
26% identity, 38% coverage: 465:769/804 of query aligns to 29:330/362 of 1wopA
- active site: D96 (= D530)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ F487), L55 (≠ R491), Y83 (≠ L517), D96 (= D530), V98 (≠ T532), E106 (= E540), L108 (≠ Q542), V110 (≠ T544), N112 (≠ S546), I137 (= I570), E160 (≠ R593), Y168 (≠ F603), Y169 (≠ F604), K173 (≠ P608), S174 (≠ M609), I175 (≠ T610), E180 (≠ H615), T181 (≠ C616), Y188 (= Y623), E195 (= E630), M197 (≠ Y632), R227 (≠ M662), Y236 (≠ F671)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
26% identity, 38% coverage: 465:769/804 of query aligns to 29:330/362 of 1wooA
- active site: D96 (= D530)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ F487), Y83 (≠ L517), D96 (= D530), V98 (≠ T532), V110 (≠ T544), N112 (≠ S546), Y168 (≠ F603), Y169 (≠ F604), Y188 (= Y623), E195 (= E630), Y236 (≠ F671)
Sites not aligning to the query:
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
24% identity, 48% coverage: 417:804/804 of query aligns to 573:965/965 of 2gagA
Sites not aligning to the query:
- active site: 350, 375
- binding flavin mononucleotide: 510, 511, 517, 521, 549, 551
- binding nicotinamide-adenine-dinucleotide: 134, 135, 137, 138, 139, 158, 159, 160, 165, 166, 204, 205, 249, 250, 295, 381, 417, 418, 423, 424, 425, 554
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
24% identity, 48% coverage: 417:804/804 of query aligns to 575:967/967 of Q46337
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 139 G→A: Does not affect activity and binding of NAD(+).
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
26% identity, 30% coverage: 467:710/804 of query aligns to 612:862/965 of Q50LF0
Sites not aligning to the query:
- 139 binding
- 158 binding
- 159 binding
- 160 binding
- 166 binding
- 205 binding
- 418 binding
- 423 binding
- 425 binding
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
26% identity, 30% coverage: 467:710/804 of query aligns to 611:861/963 of 3ad7A
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
26% identity, 30% coverage: 467:710/804 of query aligns to 611:861/963 of 1vrqA
- active site: D676 (= D530)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (≠ F487), Y663 (≠ L517), G677 (≠ F531), H690 (≠ T544), I774 (≠ V621), F776 (≠ Y623), E783 (= E630), K822 (= K669), F824 (= F671)
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
21% identity, 47% coverage: 2:382/804 of query aligns to 17:387/403 of 2gagB
- active site: A61 (≠ W45), T64 (≠ A48), T65 (≠ G49)
- binding flavin-adenine dinucleotide: G26 (= G11), G28 (= G13), G29 (≠ V14), H30 (≠ V15), E51 (= E35), K52 (≠ R36), G58 (= G42), N59 (≠ S43), M60 (≠ T44), R62 (≠ H46), N63 (≠ A47), T64 (≠ A48), I66 (≠ G50), V195 (= V174), G224 (= G203), A225 (≠ G204), H227 (≠ W206), L231 (≠ V210), L246 (≠ H225), G352 (vs. gap), T353 (≠ M348), G354 (≠ A349), G355 (= G350), F356 (= F351), K357 (≠ S352)
- binding flavin mononucleotide: A61 (≠ W45), R62 (≠ H46), H171 (≠ P150), V250 (= V229), E278 (vs. gap), R321 (≠ S316), W323 (≠ I318)
- binding 2-furoic acid: T64 (≠ A48), I66 (≠ G50), R68 (≠ H52), M263 (≠ E242), Y270 (= Y254), K357 (≠ S352)
- binding sulfite ion: K170 (≠ D149), K276 (≠ R260)
Sites not aligning to the query:
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
23% identity, 36% coverage: 91:382/804 of query aligns to 113:389/405 of Q50LF2
- K172 (≠ D149) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ P150) modified: Tele-8alpha-FMN histidine
- V197 (= V174) binding
- H270 (≠ E252) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (= Y254) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (vs. gap) binding
- G357 (= G350) binding
- K359 (≠ S352) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
23% identity, 36% coverage: 91:382/804 of query aligns to 112:388/404 of 3ad8B
- active site: G326 (= G320), K358 (≠ S352)
- binding flavin-adenine dinucleotide: V196 (= V174), G225 (= G203), A226 (≠ G204), H228 (≠ W206), L247 (≠ H225), G353 (vs. gap), T354 (≠ M348), G355 (≠ A349), G356 (= G350), F357 (= F351), K358 (≠ S352)
- binding flavin mononucleotide: H172 (≠ P150), V251 (= V229), E279 (vs. gap), R322 (≠ S316), W324 (≠ I318)
- binding pyrrole-2-carboxylate: M264 (≠ E242), Y271 (= Y254), T354 (≠ M348), K358 (≠ S352)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
Query Sequence
>3608080 FitnessBrowser__Dino:3608080
MKSHTQVCVIGGGVVGCSVLYHLTKLGWSDVMLLERSELTSGSTWHAAGGFHTLNGDTNM
AALQGYTIGLYKELEALTGLSCGLHHVGGITLADTPERFDMLKAERAKHRYMGLETEILG
PAEIKAMADLVNTDGILGGLYDPLDGHLDPSGTTHAYAKAAKLGGAQIHTHTMVTATTPN
PDGTWTVETDKGTVIAEHLVNAGGLWAREVAAMAGVYLPLLPMAHQYIVTDDIPEIYTRA
TEFPHVIDPGGESYLRQEGRGLCIGFYEKPCEAWSVDGTPWDFGHELLNDQFEKIEDSIA
FAYRRFPVLETAGVKSVIHGPFTFAPDGNPLVGPVPGLRNYWSACAVMAGFSQGGGVGLA
LAQWMIEGETERDPRAMDVARFGRWTTPGYTVPKVIENYQNRFSVSYPNEELPAARPFRT
TAMYDIWDGMGAVFGQTYGLEVVNYFAPEGAPRFETPSFRRSNAWGAVKAEVMAVRTGVG
INELQNFGKFRVTGPGARAWLDRIMAGRIPAPRRLSLSPMLAPSGRLIGDFTISCLSETE
FQLTASYGAQDYHLRWFQTHLDDGVTVENISDARTGFQIAGPRAREVLAACTRADVSAEA
FRFFDVAPMTIGMAHCLVQRVSYTGDLGYEIYCSPTEQRHLFHTLWEAGQPHGIRPFGMR
AMMSLRLDKFFGAWSREYSPDYTAAETGLDRFIHFGKNTAFIGRNAAEAERATPPARQLC
AFEVAATDADVVAYEPISLDGEVVGFCTSGGYAHFTGKSIALGFVPREMAQDGLEASIEI
LGDHCPATLITTPLFDPDGARMRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory