Comparing 3608082 FitnessBrowser__Dino:3608082 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
38% identity, 43% coverage: 8:302/693 of query aligns to 2:302/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 47% coverage: 9:331/693 of query aligns to 4:321/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 47% coverage: 9:331/693 of query aligns to 3:310/310 of 4fwiB
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 33% coverage: 380:611/693 of query aligns to 17:247/250 of 7z18I
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 33% coverage: 380:611/693 of query aligns to 17:247/253 of 7z15I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 33% coverage: 380:611/693 of query aligns to 17:247/250 of 7z16I
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 32% coverage: 384:608/693 of query aligns to 44:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
36% identity, 32% coverage: 384:608/693 of query aligns to 44:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
36% identity, 32% coverage: 384:605/693 of query aligns to 44:260/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 34% coverage: 379:613/693 of query aligns to 19:248/375 of 2d62A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 34% coverage: 385:618/693 of query aligns to 36:258/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 37% coverage: 9:262/693 of query aligns to 1:243/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 37% coverage: 9:262/693 of query aligns to 2:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 37% coverage: 9:262/693 of query aligns to 2:244/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 37% coverage: 9:262/693 of query aligns to 2:244/344 of 6cvlD
1g291 Malk (see paper)
33% identity, 34% coverage: 379:613/693 of query aligns to 16:245/372 of 1g291
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 33% coverage: 385:611/693 of query aligns to 22:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 33% coverage: 385:611/693 of query aligns to 22:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 33% coverage: 385:611/693 of query aligns to 22:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 33% coverage: 385:611/693 of query aligns to 22:241/242 of 2oljA
Sites not aligning to the query:
>3608082 FitnessBrowser__Dino:3608082
MTETYDGPILEIENLSISFFTRLREIPAVMDFSCTVMPGEAMGLVGESGCGKSTVALGVM
QDLGVNGRIVGGTIKFKGRDLNTMSPEELRRIRGKEIAMIYQEPMASLNPAMRIGKQLME
VPMIHEGVSEDVAYQRALDVVTDVRLPDPKRILNSFPHQLSGGQQQRIVIAMALMANPAL
LILDEPTTALDVTVEAAVVDLVKDLGKKYGTSMLFISHNLGLILETCDRLCVMYSGEAVE
TGSIEDVFDEMQHPYTQALFRSIPLPGADKNARPLVAIPGNFPLPHERPKGCNFGPHCDY
FQPGLCDAQDIRMRKIPGDDRHGSRCLRFEEIDWNAPVEKADQTEKPEPGRVVLNMDNLK
KYYEVAASALFGGKNKKVVKANEDLSFEAREGETLAIVGESGCGKSTFAKVLMGLETATD
GTILLDNREIQDIEIQDRDTKTVADVQMVFQNPFDTLNPSMTVGRQIIRALEIFGVGDTE
DARKQRMLELLDLVKLPRAFANRMPRQLSGGQKQRVGIARAFAGDARIVVADEPVSALDV
SVQAAVTDLLMEIQRQNQTTLLFISHDLSIVRYLSDRVMVMYLGHVVELGTTDEVFSPPY
HPYTEALLSAVPIADTSIQKERIVLDGDIPSAMNPPPGCPFQTRCRWKSEVPGNLCETQV
PPQRKTPTGHQIKCHLSEESFARMGPVIKMAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory