Comparing 3608110 FitnessBrowser__Dino:3608110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
49% identity, 75% coverage: 14:102/119 of query aligns to 16:104/200 of 6j2lA
Sites not aligning to the query:
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
39% identity, 92% coverage: 7:116/119 of query aligns to 8:117/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
41% identity, 86% coverage: 7:108/119 of query aligns to 10:111/213 of 7bgmA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
49% identity, 71% coverage: 14:97/119 of query aligns to 15:99/185 of 6j2lB
Sites not aligning to the query:
>3608110 FitnessBrowser__Dino:3608110
MEFDPASLRYDDQGLIPAIAQDAASGEVLMMAWMNAEAVARTLETGRVTYWSRSRQAFWI
KGESSGHVQTLVEMRVDCDRDCLLLQVRQEGPACHTNRRTCFYTAIRDGAEVELMAPMV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory