Comparing 3608115 Dshi_1520 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
43% identity, 76% coverage: 67:276/277 of query aligns to 27:238/240 of 1ji0A
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
35% identity, 78% coverage: 61:276/277 of query aligns to 17:235/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
36% identity, 79% coverage: 57:276/277 of query aligns to 13:235/235 of 6mhzA
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
36% identity, 79% coverage: 57:276/277 of query aligns to 13:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
36% identity, 79% coverage: 57:276/277 of query aligns to 13:235/238 of 6s8gA
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 78% coverage: 62:276/277 of query aligns to 20:253/254 of 1g6hA
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
36% identity, 79% coverage: 57:276/277 of query aligns to 14:236/241 of 6mbnA
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 78% coverage: 62:276/277 of query aligns to 20:253/253 of 1g9xB
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
35% identity, 83% coverage: 46:275/277 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
35% identity, 83% coverage: 46:275/277 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
35% identity, 83% coverage: 46:274/277 of query aligns to 3:233/233 of 6b8bA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
32% identity, 70% coverage: 62:254/277 of query aligns to 268:472/501 of P04983
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
35% identity, 81% coverage: 55:277/277 of query aligns to 10:240/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
35% identity, 81% coverage: 55:277/277 of query aligns to 12:242/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
35% identity, 81% coverage: 55:277/277 of query aligns to 12:242/263 of 7d08B
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
27% identity, 81% coverage: 46:268/277 of query aligns to 4:226/393 of P9WQI3
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 70% coverage: 54:246/277 of query aligns to 10:205/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 79% coverage: 58:277/277 of query aligns to 29:246/378 of P69874
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 70% coverage: 62:254/277 of query aligns to 16:205/348 of 3d31A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 70% coverage: 61:254/277 of query aligns to 17:219/241 of 4u00A
Sites not aligning to the query:
>3608115 Dshi_1520 ABC transporter related (RefSeq)
MSAQNPYQEARGNKDASITNPRPGGTLTPGTAPEGRSAAHPGEPFLIGDGMTGGYGSGAD
ILHDCTLAVDRGEIAVIVGPNGAGKSTAMKAVFGMLNIHTGSVRLDGEDITGLSPQARVA
KGMAFVPQVNNIFTTMTVEENLEMGAFLRRDDISETMEQVYELFPILREKRRQAAGELSG
GQRQQVAVGRALMTRPQVLMLDEPTAGVSPIVMDELFDRIIEVARTGISILMVEQNARQA
LEIADKGYVLVQGRNRYTDTGQALLADPDVRKSFLGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory