Comparing 3608116 Dshi_1521 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
40% identity, 96% coverage: 1:249/260 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
40% identity, 96% coverage: 1:249/260 of query aligns to 4:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 97% coverage: 1:253/260 of query aligns to 2:239/240 of 6mjpA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
31% identity, 97% coverage: 1:251/260 of query aligns to 6:240/240 of 1ji0A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
31% identity, 95% coverage: 2:249/260 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 95% coverage: 2:249/260 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 95% coverage: 2:249/260 of query aligns to 3:235/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 97% coverage: 2:253/260 of query aligns to 4:240/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
31% identity, 95% coverage: 2:248/260 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
31% identity, 95% coverage: 2:248/260 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
30% identity, 95% coverage: 2:247/260 of query aligns to 3:233/233 of 6b8bA
P34358 ABC transporter ced-7; Cell death protein 7 from Caenorhabditis elegans (see 2 papers)
32% identity, 96% coverage: 2:251/260 of query aligns to 546:771/1704 of P34358
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
29% identity, 95% coverage: 2:249/260 of query aligns to 7:230/353 of 1vciA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
32% identity, 92% coverage: 1:238/260 of query aligns to 4:224/285 of 4yerA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 95% coverage: 1:248/260 of query aligns to 2:236/241 of 4u00A
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 92% coverage: 1:239/260 of query aligns to 4:230/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 92% coverage: 1:239/260 of query aligns to 4:230/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 92% coverage: 1:239/260 of query aligns to 2:228/253 of 6z5uK
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
26% identity, 91% coverage: 1:237/260 of query aligns to 1:228/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
25% identity, 91% coverage: 1:237/260 of query aligns to 2:229/344 of 3tuzC
Sites not aligning to the query:
>3608116 Dshi_1521 ABC transporter related (RefSeq)
MIKVENLHKHFGGFRAVDGATLEIAEGSITGLVGPNGAGKTTLFNVIAGNLQPTSGKVTM
LGEDITGLPPHDLFHKGLLRTFQIAHEFGSMTVRENLMMVPGAQSGETMWNAWFKRGQIA
REEAALGKKADEVLEFLTIDHLRDERAGNLSGGQKKLLELGRTMMVDAKIVFLDEVGAGV
NRTLLGTIADAILRLNQERGYTFCVIEHDMDFIGKLCDPVIVMAEGKKLAEGTIDEIKAN
EQVIEAYLGTGLKNKEKTPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory