Comparing 3608118 FitnessBrowser__Dino:3608118 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
41% identity, 98% coverage: 6:365/369 of query aligns to 5:369/371 of P75804
7cdyA Crystal structure of glucose dehydrogenase
43% identity, 87% coverage: 33:354/369 of query aligns to 3:333/346 of 7cdyA
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
42% identity, 91% coverage: 31:365/369 of query aligns to 3:347/348 of 2g8sA
7cgzA Glucose dehydrogenase
39% identity, 87% coverage: 33:354/369 of query aligns to 3:308/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
35% identity, 87% coverage: 31:351/369 of query aligns to 2:310/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
32% identity, 88% coverage: 32:357/369 of query aligns to 5:316/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
32% identity, 88% coverage: 32:357/369 of query aligns to 5:316/338 of 3a9gA
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
25% identity, 95% coverage: 2:353/369 of query aligns to 15:445/478 of P13650
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
24% identity, 92% coverage: 15:353/369 of query aligns to 4:419/448 of 1cruA
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
25% identity, 92% coverage: 15:353/369 of query aligns to 4:415/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
25% identity, 92% coverage: 15:353/369 of query aligns to 4:415/444 of 1c9uA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
30% identity, 73% coverage: 33:301/369 of query aligns to 11:263/334 of 3dasA
Sites not aligning to the query:
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
24% identity, 92% coverage: 15:353/369 of query aligns to 4:421/453 of 5minB
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
25% identity, 52% coverage: 33:225/369 of query aligns to 5:213/417 of 2wfxB
Sites not aligning to the query:
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
25% identity, 60% coverage: 33:252/369 of query aligns to 7:248/437 of 7pgnA
Sites not aligning to the query:
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
26% identity, 54% coverage: 33:233/369 of query aligns to 6:225/438 of 7pgnB
Sites not aligning to the query:
Q96QV1 Hedgehog-interacting protein; HHIP; HIP from Homo sapiens (Human) (see 3 papers)
26% identity, 52% coverage: 33:225/369 of query aligns to 219:438/700 of Q96QV1
Sites not aligning to the query:
7pgmB Hhip-c in complex with heparin (see paper)
26% identity, 54% coverage: 33:230/369 of query aligns to 6:218/427 of 7pgmB
Sites not aligning to the query:
>3608118 FitnessBrowser__Dino:3608118
MIRLVTMIALGLSLLSPAAWAETLTTSAGPVEVKEIVRDLDEPWAFGFLPEGGVLITERG
GALLHIRPDGTRTEVSGLPRIAVGGQGGLLDLLIPADFAQTREVVFSYSRPQARGAGTAV
AVGRFSADGRALENTRTIFAMEEGTRGGRHFGSRIVEGRDGFLYVTIGDRGDDDSAQNLA
IESGSVIRIARDGGIPTSNPFTGTEGAQPEIWSYGHRNPQGAALDLQGNLWVVEHGARGG
DEINRVEMGANYGWPVISYGRHYSGLRIGEGTAKPGMEQPAHFWDPSIAPSGMMIYSGAL
WPEWEGDFFVGSLKFGYLSRLEAGSFAEEEITGDTTARLRDVREGPDGAIWFLSVGNGAL
YRMSPAERS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory