Comparing 3608125 FitnessBrowser__Dino:3608125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n27A X-ray structure of brucella abortus rica (see paper)
58% identity, 98% coverage: 2:171/174 of query aligns to 3:172/175 of 4n27A
7zw9A Crystal structure of a gamma-carbonic anhydrase from the pathogenic bacterium burkholderia pseudomallei (see paper)
54% identity, 99% coverage: 2:174/174 of query aligns to 3:173/173 of 7zw9A
6iveA Molecular structure of a thermostable and a zinc ion binding gamma- class carbonic anhydrase (see paper)
44% identity, 88% coverage: 19:171/174 of query aligns to 17:163/168 of 6iveA
2fkoA Structure of ph1591 from pyrococcus horikoshii ot3 (see paper)
49% identity, 84% coverage: 2:147/174 of query aligns to 3:146/173 of 2fkoA
Sites not aligning to the query:
1v3wA Structure of ferripyochelin binding protein from pyrococcus horikoshii ot3 (see paper)
49% identity, 84% coverage: 2:147/174 of query aligns to 3:146/173 of 1v3wA
Sites not aligning to the query:
8e73G2 qcr9 (see paper)
41% identity, 83% coverage: 17:160/174 of query aligns to 57:201/258 of 8e73G2
Q5KW03 Carbonic anhydrase; Gamma-carbonic anhydrase; Cag; EC 4.2.1.1 from Geobacillus kaustophilus (strain HTA426) (see paper)
42% identity, 84% coverage: 1:147/174 of query aligns to 1:145/182 of Q5KW03
Sites not aligning to the query:
3vnpA Crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
42% identity, 84% coverage: 1:147/174 of query aligns to 2:146/171 of 3vnpA
7aqqz Cryo-em structure of arabidopsis thaliana complex-i (membrane core) (see paper)
41% identity, 82% coverage: 19:160/174 of query aligns to 59:206/233 of 7aqqz
Sites not aligning to the query:
7a23p Plant mitochondrial respiratory complex i (see paper)
41% identity, 82% coverage: 19:160/174 of query aligns to 55:202/224 of 7a23p
Sites not aligning to the query:
7ar7y Cryo-em structure of arabidopsis thaliana complex-i (open conformation) (see paper)
39% identity, 83% coverage: 17:160/174 of query aligns to 57:206/268 of 7ar7y
Sites not aligning to the query:
7aqqy Cryo-em structure of arabidopsis thaliana complex-i (membrane core) (see paper)
39% identity, 83% coverage: 17:160/174 of query aligns to 57:206/268 of 7aqqy
8bpxy Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (see paper)
39% identity, 83% coverage: 17:160/174 of query aligns to 58:207/265 of 8bpxy
Sites not aligning to the query:
8befy Cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane core) (see paper)
39% identity, 83% coverage: 17:160/174 of query aligns to 58:207/265 of 8befy
Sites not aligning to the query:
3tioF Crystal structures of yrda from escherichia coli, a homologous protein of gamma-class carbonic anhydrase, show possible allosteric conformations (see paper)
39% identity, 86% coverage: 12:160/174 of query aligns to 10:166/177 of 3tioF
6sc4B Gamma-carbonic anhydrase from the haloarchaeon halobacterium sp. (see paper)
33% identity, 92% coverage: 1:160/174 of query aligns to 2:167/178 of 6sc4B
3r3rA Structure of the yrda ferripyochelin binding protein from salmonella enterica
41% identity, 78% coverage: 26:160/174 of query aligns to 30:171/184 of 3r3rA
3ixcA Crystal structure of hexapeptide transferase family protein from anaplasma phagocytophilum
36% identity, 93% coverage: 7:167/174 of query aligns to 10:165/166 of 3ixcA
8gpmA Acinetobacter baumannii carbonic anhydrase
42% identity, 85% coverage: 3:150/174 of query aligns to 4:149/193 of 8gpmA
8gppA Acinetobacter baumannii carbonic anhydrase paay
42% identity, 85% coverage: 3:150/174 of query aligns to 3:148/189 of 8gppA
Sites not aligning to the query:
>3608125 FitnessBrowser__Dino:3608125
MIYALDGIAPQFPASGNYWVAPDANLIGKVVLEEASSVWFGATLRGDNEEIRLGTGSNIQ
EACVLHTDMGFPLTIGTNCTIGHKAILHGCTIGDGSLVGMGATILNGARIGKGCLIGAGA
LVTESKEIPDFSLVMGAPGKVVRTLDETAQAGLLESATGYQANMRRFRAGLTAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory