Comparing 3608131 FitnessBrowser__Dino:3608131 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
58% identity, 96% coverage: 12:264/264 of query aligns to 6:257/257 of P0AAH0
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 92% coverage: 17:259/264 of query aligns to 3:236/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
38% identity, 89% coverage: 26:260/264 of query aligns to 13:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
38% identity, 89% coverage: 26:260/264 of query aligns to 13:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
38% identity, 89% coverage: 26:260/264 of query aligns to 13:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
38% identity, 89% coverage: 26:260/264 of query aligns to 13:239/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 92% coverage: 17:260/264 of query aligns to 2:237/240 of 4ymuJ
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 88% coverage: 27:259/264 of query aligns to 37:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
34% identity, 88% coverage: 27:259/264 of query aligns to 37:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
35% identity, 85% coverage: 27:250/264 of query aligns to 37:254/260 of 7ahdC
Sites not aligning to the query:
7y48B Cryo-em structure of biliverdin-bound mitochondrial abc transporter abcb10 from biortus
34% identity, 90% coverage: 14:250/264 of query aligns to 335:565/567 of 7y48B
Sites not aligning to the query:
4ayxA Structure of the human mitochondrial abc transporter, abcb10 (rod form b) (see paper)
34% identity, 90% coverage: 14:250/264 of query aligns to 336:569/571 of 4ayxA
Sites not aligning to the query:
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 96% coverage: 11:263/264 of query aligns to 1:257/258 of P02915
Q9NRK6 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein; Mitochondrial ATP-binding cassette 2; M-ABC2 from Homo sapiens (Human) (see 5 papers)
34% identity, 90% coverage: 14:251/264 of query aligns to 489:723/738 of Q9NRK6
Sites not aligning to the query:
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
35% identity, 94% coverage: 15:263/264 of query aligns to 1:253/258 of 1b0uA
Q9JI39 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein from Mus musculus (Mouse) (see 2 papers)
32% identity, 91% coverage: 12:250/264 of query aligns to 452:687/715 of Q9JI39
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 88% coverage: 28:259/264 of query aligns to 17:241/343 of P30750
Sites not aligning to the query:
4q9iA P-glycoprotein cocrystallised with qz-ala (see paper)
33% identity, 86% coverage: 14:241/264 of query aligns to 356:577/1184 of 4q9iA
Sites not aligning to the query:
6q81A Structure of p-glycoprotein(abcb1) in the post-hydrolytic state (see paper)
33% identity, 86% coverage: 14:241/264 of query aligns to 353:574/1182 of 6q81A
Sites not aligning to the query:
3g61A Structure of p-glycoprotein reveals a molecular basis for poly- specific drug binding (see paper)
33% identity, 86% coverage: 14:241/264 of query aligns to 353:574/1182 of 3g61A
Sites not aligning to the query:
>3608131 FitnessBrowser__Dino:3608131
MNDMRLTERAVTEQTKIAAKNVQVYYGTTHAIKDVNVDILDKTVTAFIGPSGCGKSTFLR
CLNRMNDTIDTARIEGDIRIDGEDIYDRRVDPVQLRAKVGMVFQKPNPFPKSIYDNVAYG
PRIHGLARTRAELDEIVEKSLRRAALWDEAKDRLDQPGTGLSGGQQQRLCIARAVATSPE
VLLMDEPCSALDPIATAQVEELIDELRERYSVVIVTHSMQQAARVSQRTAFFHLGHLVEY
GETGHIFTNPEDPRTESYITGRIG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory