SitesBLAST
Comparing 3608146 FitnessBrowser__Dino:3608146 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P15474 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
55% identity, 98% coverage: 3:149/150 of query aligns to 10:156/157 of P15474
- R24 (= R17) mutation to A: Reduces kcat 30000-fold. Reduces KM for 3-dehydroquinate 6-fold.; mutation to K: Reduces kcat 2700-fold. Reduces KM for 3-dehydroquinate 4-fold.; mutation to Q: Reduces kcat 3100-fold. Reduces KM for 3-dehydroquinate 8-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1v1jA Crystal structure of type ii dehydroquintae dehydratase from streptomyces coelicolor in complex with 3-fluoro (see paper)
55% identity, 92% coverage: 3:140/150 of query aligns to 9:147/150 of 1v1jA
- active site: P15 (= P9), N16 (= N10), R23 (= R17), Y28 (= Y22), N79 (= N73), A82 (= A76), E104 (= E97), H106 (= H99), R113 (= R106)
- binding 2-anhydro-3-fluoro-quinic acid: Y28 (= Y22), N79 (= N73), A81 (≠ G75), A82 (= A76), H85 (= H79), H106 (= H99), I107 (≠ L100), S108 (= S101), R117 (= R110)
2cjfA Type ii dehydroquinase inhibitor complex (see paper)
55% identity, 92% coverage: 3:140/150 of query aligns to 8:146/149 of 2cjfA
- binding (1s,4s,5s)-1,4,5-trihydroxy-3-[3-(phenylthio)phenyl]cyclohex-2-ene-1-carboxylic acid: N15 (= N10), L16 (= L11), L18 (= L13), L19 (= L14), R22 (= R17), Y27 (= Y22), N78 (= N73), A80 (≠ G75), A81 (= A76), H84 (= H79), H105 (= H99), I106 (≠ L100), S107 (= S101), R116 (= R110)
2bt4A Type ii dehydroquinase inhibitor complex (see paper)
55% identity, 92% coverage: 3:140/150 of query aligns to 8:146/149 of 2bt4A
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N15 (= N10), L18 (= L13), R22 (= R17), Y27 (= Y22), N78 (= N73), A80 (≠ G75), A81 (= A76), H84 (= H79), H105 (= H99), I106 (≠ L100), S107 (= S101), R116 (= R110)
1gu1A Crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with 2,3-anhydro-quinic acid (see paper)
55% identity, 92% coverage: 3:140/150 of query aligns to 8:146/149 of 1gu1A
- active site: P14 (= P9), N15 (= N10), R22 (= R17), Y27 (= Y22), N78 (= N73), A81 (= A76), E103 (= E97), H105 (= H99), R112 (= R106)
- binding 2,3 -anhydro-quinic acid: Y27 (= Y22), N78 (= N73), A80 (≠ G75), A81 (= A76), H84 (= H79), H105 (= H99), I106 (≠ L100), S107 (= S101), R116 (= R110)
- binding glycerol: N15 (= N10), L16 (= L11), L19 (= L14), Y27 (= Y22)
1gtzA Structure of streptomyces coelicolor type ii dehydroquinase r23a mutant in complex with dehydroshikimate (see paper)
55% identity, 92% coverage: 3:140/150 of query aligns to 8:146/149 of 1gtzA
- active site: P14 (= P9), N15 (= N10), A22 (≠ R17), Y27 (= Y22), N78 (= N73), A81 (= A76), E103 (= E97), H105 (= H99), R112 (= R106)
- binding 3-dehydroshikimate: Y27 (= Y22), A80 (≠ G75), A81 (= A76), H84 (= H79), H105 (= H99), I106 (≠ L100), S107 (= S101), R116 (= R110)
8idrC Crystal structure of apo-form of dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
54% identity, 89% coverage: 3:136/150 of query aligns to 4:137/147 of 8idrC
5ydbA Crystal structure of the complex of type ii dehydroquinate dehydratase from acinetobacter baumannii with dehydroquinic acid at 1.76 angstrom resolution
53% identity, 89% coverage: 3:136/150 of query aligns to 3:137/145 of 5ydbA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N74 (= N73), A77 (= A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: N74 (= N73), A76 (≠ G75), A77 (= A76), H80 (= H79), H100 (= H99), L101 (= L100), S102 (= S101), R111 (= R110)
5b6pB Structure of the dodecameric type-ii dehydrogenate dehydratase from acinetobacter baumannii at 2.00 a resolution (see paper)
53% identity, 89% coverage: 3:136/150 of query aligns to 3:137/145 of 5b6pB
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N74 (= N73), A77 (= A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding sulfate ion: N74 (= N73), H100 (= H99), L101 (= L100), S102 (= S101)
8iduA Crystal structure of substrate bound-form dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
54% identity, 89% coverage: 3:136/150 of query aligns to 4:137/145 of 8iduA
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: Y23 (= Y22), N74 (= N73), G76 (= G75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (≠ L100), S102 (= S101), R111 (= R110)
4b6pA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
48% identity, 93% coverage: 3:142/150 of query aligns to 3:142/142 of 4b6pA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N10), L14 (= L14), R17 (= R17), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
3n76A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with compound 5 (see paper)
48% identity, 93% coverage: 3:142/150 of query aligns to 4:143/143 of 3n76A
- active site: P10 (= P9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N11 (= N10), R14 (≠ L13), R18 (= R17), Y23 (= Y22), N74 (= N73), G76 (= G75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (≠ L100), S102 (= S101), R111 (= R110)
3n8kM Type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid (see paper)
48% identity, 93% coverage: 3:142/150 of query aligns to 12:151/151 of 3n8kM
- active site: P18 (= P9), N19 (= N10), N82 (= N73), G85 (≠ A76), E106 (= E97), H108 (= H99), R115 (= R106)
- binding 2,6-dioxo-1,2,3,6-tetrahydropyridine-4-carboxylic acid: R26 (= R17), Y31 (= Y22), N82 (= N73), G84 (= G75), H88 (= H79), H108 (= H99), I109 (≠ L100), S110 (= S101), R119 (= R110)
4kiwA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid] (see paper)
48% identity, 93% coverage: 3:141/150 of query aligns to 3:141/141 of 4kiwA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding 5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid: N10 (= N10), L11 (= L11), R13 (≠ L13), L14 (= L14), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), V103 (≠ I103), R110 (= R110)
4kiuA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49d [5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid] (see paper)
48% identity, 93% coverage: 3:141/150 of query aligns to 3:141/141 of 4kiuA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding 5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid: N10 (= N10), R13 (≠ L13), L14 (= L14), E18 (≠ Q18), Y22 (= Y22), G75 (= G75), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
4ciwA Crystal structure of mycobacterium tuberculosis type 2 dehydroquinase in complex with (1r,4r,5r)-1,4,5-trihydroxy-3-(2-hydroxy) ethylcyclohex-2-ene-1-carboxylic acid (see paper)
48% identity, 93% coverage: 3:141/150 of query aligns to 3:141/141 of 4ciwA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-(2-hydroxy)ethylcyclohex-2-ene-1-carboxylic acid: Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
3n87A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 3 (see paper)
48% identity, 93% coverage: 3:141/150 of query aligns to 3:141/141 of 3n87A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-[3-(phenylcarbonyl)phenyl]cyclohex-2-ene-1-carboxylic acid: N10 (= N10), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
3n86A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 4 (see paper)
48% identity, 93% coverage: 3:141/150 of query aligns to 3:141/141 of 3n86A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,5R)-1,5-dihydroxy-4-oxo-3-[3-oxo-3-(phenylamino)propyl]cyclohex-2-ene-1-carboxylic acid: N10 (= N10), R13 (≠ L13), E18 (≠ Q18), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), D86 (= D86), E90 (≠ S90), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
2xb8A Structure of mycobacterium tuberculosis type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3- dehydroquinic acid (see paper)
48% identity, 93% coverage: 3:141/150 of query aligns to 3:141/141 of 2xb8A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1r,2r,4s,5r)-1,4,5-trihydroxy-2-(4-methoxybenzyl)-3-oxocyclohexanecarboxylic acid: N10 (= N10), L11 (= L11), Y22 (= Y22), N73 (= N73), G75 (= G75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), V103 (≠ I103), R110 (= R110)
4b6oA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
48% identity, 93% coverage: 3:141/150 of query aligns to 4:142/142 of 4b6oA
- active site: P10 (= P9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N11 (= N10), N74 (= N73), G76 (= G75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (≠ L100), S102 (= S101), R111 (= R110)
Query Sequence
>3608146 FitnessBrowser__Dino:3608146
MHITILNGPNLNLLGTRQPEVYGATTLADIEHMCQRKAQALGLEIEFNQTNHEGVLIDQI
HAARSESDGLIINAGAYTHTSVALMDAVASVSLPTVEVHLSNIHARESFRHTSFLSPVAL
GLICGFGATGYVMALDGIWAHLTAADSARP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory