SitesBLAST
Comparing 3608199 FitnessBrowser__Dino:3608199 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
36% identity, 97% coverage: 5:261/264 of query aligns to 4:254/257 of 6slbAAA
- active site: Q64 (≠ H65), F69 (≠ M70), L80 (≠ F88), N84 (≠ A92), A108 (= A116), S111 (≠ Q119), A130 (≠ N138), F131 (≠ G139), L136 (= L144), P138 (= P149), D139 (≠ M150), A224 (= A231), G234 (≠ M241)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (= R59), A62 (= A63), Q64 (≠ H65), D65 (= D66), L66 (= L67), Y76 (≠ F84), A108 (= A116), F131 (≠ G139), D139 (≠ M150)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
36% identity, 97% coverage: 5:261/264 of query aligns to 1:242/245 of 6slaAAA
- active site: Q61 (≠ H65), L68 (≠ A72), N72 (≠ D89), A96 (= A116), S99 (≠ Q119), A118 (≠ N138), F119 (≠ G139), L124 (= L144), P126 (= P149), N127 (≠ M150), A212 (= A231), G222 (≠ M241)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (= L25), A59 (= A63), Q61 (≠ H65), D62 (= D66), L63 (= L67), L68 (≠ A72), Y71 (≠ F88), A94 (≠ T114), G95 (≠ A115), A96 (= A116), F119 (≠ G139), I122 (= I142), L124 (= L144), N127 (≠ M150), F234 (= F253), K237 (= K256)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
33% identity, 93% coverage: 17:262/264 of query aligns to 17:257/259 of 5zaiC
- active site: A65 (≠ H65), F70 (≠ M70), S82 (≠ D89), R86 (= R93), G110 (≠ A116), E113 (≠ Q119), P132 (≠ N138), E133 (≠ G139), I138 (≠ L144), P140 (≠ C146), G141 (≠ S147), A226 (= A231), F236 (≠ M241)
- binding coenzyme a: K24 (≠ S24), L25 (= L25), A63 (= A63), G64 (= G64), A65 (≠ H65), D66 (= D66), I67 (≠ L67), P132 (≠ N138), R166 (≠ M171), F248 (= F253), K251 (= K256)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
31% identity, 95% coverage: 14:263/264 of query aligns to 15:257/258 of 1ey3A
- active site: A66 (≠ H65), M71 (= M70), S81 (≠ A81), L85 (≠ K85), G109 (≠ A116), E112 (≠ Q119), P131 (≠ N138), E132 (≠ G139), T137 (≠ S147), P139 (= P149), G140 (≠ M150), K225 (≠ A231), F235 (≠ M241)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ Q23), L26 (= L25), A28 (≠ V27), A64 (= A63), G65 (= G64), A66 (≠ H65), D67 (= D66), I68 (≠ L67), L85 (≠ K85), W88 (≠ F88), G109 (≠ A116), P131 (≠ N138), L135 (≠ I142), G140 (≠ M150)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
31% identity, 95% coverage: 14:263/264 of query aligns to 17:259/260 of 1dubA
- active site: A68 (≠ H65), M73 (= M70), S83 (≠ A81), L87 (≠ K85), G111 (≠ A116), E114 (≠ Q119), P133 (≠ N138), E134 (≠ G139), T139 (≠ S147), P141 (= P149), G142 (≠ M150), K227 (≠ A231), F237 (≠ M241)
- binding acetoacetyl-coenzyme a: K26 (≠ Q23), A27 (≠ S24), L28 (= L25), A30 (≠ V27), A66 (= A63), A68 (≠ H65), D69 (= D66), I70 (≠ L67), Y107 (≠ I112), G110 (≠ A115), G111 (≠ A116), E114 (≠ Q119), P133 (≠ N138), E134 (≠ G139), L137 (≠ I142), G142 (≠ M150), F233 (≠ M237), F249 (= F253)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 95% coverage: 14:263/264 of query aligns to 47:289/290 of P14604
- E144 (≠ Q119) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ G139) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
30% identity, 95% coverage: 14:263/264 of query aligns to 16:253/254 of 2dubA
- active site: A67 (≠ H65), M72 (= M70), S82 (≠ R93), G105 (≠ A116), E108 (≠ Q119), P127 (≠ N138), E128 (≠ G139), T133 (≠ S147), P135 (= P149), G136 (≠ M150), K221 (≠ A231), F231 (≠ M241)
- binding octanoyl-coenzyme a: K25 (≠ Q23), A26 (≠ S24), L27 (= L25), A29 (≠ V27), A65 (= A63), A67 (≠ H65), D68 (= D66), I69 (≠ L67), K70 (= K68), G105 (≠ A116), E108 (≠ Q119), P127 (≠ N138), E128 (≠ G139), G136 (≠ M150), A137 (≠ V151)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
31% identity, 97% coverage: 8:263/264 of query aligns to 11:259/260 of 2hw5C
- active site: A68 (≠ H65), M73 (= M70), S83 (≠ A81), L87 (≠ K85), G111 (≠ A116), E114 (≠ Q119), P133 (≠ N138), E134 (≠ G139), T139 (≠ S147), P141 (= P149), G142 (≠ M150), K227 (≠ A231), F237 (≠ M241)
- binding crotonyl coenzyme a: K26 (≠ Q23), A27 (≠ S24), L28 (= L25), A30 (≠ V27), K62 (≠ R59), I70 (≠ L67), F109 (≠ T114)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
30% identity, 95% coverage: 14:263/264 of query aligns to 17:257/258 of 1mj3A
- active site: A68 (≠ H65), M73 (= M70), S83 (≠ D89), L85 (≠ C91), G109 (≠ A116), E112 (≠ Q119), P131 (≠ N138), E132 (≠ G139), T137 (≠ S147), P139 (= P149), G140 (≠ M150), K225 (≠ A231), F235 (≠ M241)
- binding hexanoyl-coenzyme a: K26 (≠ Q23), A27 (≠ S24), L28 (= L25), A30 (≠ V27), A66 (= A63), G67 (= G64), A68 (≠ H65), D69 (= D66), I70 (≠ L67), G109 (≠ A116), P131 (≠ N138), E132 (≠ G139), L135 (≠ I142), G140 (≠ M150)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
31% identity, 98% coverage: 3:262/264 of query aligns to 3:250/250 of 3q0gD
- active site: A64 (≠ H65), M69 (= M70), T75 (≠ F84), F79 (= F88), G103 (≠ A116), E106 (≠ Q119), P125 (≠ N138), E126 (≠ G139), V131 (≠ L144), P133 (= P149), G134 (≠ M150), L219 (≠ A231), F229 (≠ M241)
- binding Butyryl Coenzyme A: F225 (≠ M237), F241 (= F253)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
31% identity, 98% coverage: 3:262/264 of query aligns to 4:255/255 of 3q0jC
- active site: A65 (≠ H65), M70 (= M70), T80 (≠ K85), F84 (= F88), G108 (≠ A116), E111 (≠ Q119), P130 (≠ N138), E131 (≠ G139), V136 (≠ L144), P138 (= P149), G139 (≠ M150), L224 (≠ A231), F234 (≠ M241)
- binding acetoacetyl-coenzyme a: Q23 (= Q23), A24 (≠ S24), L25 (= L25), A27 (≠ V27), A63 (= A63), G64 (= G64), A65 (≠ H65), D66 (= D66), I67 (≠ L67), K68 (= K68), M70 (= M70), F84 (= F88), G107 (≠ A115), G108 (≠ A116), E111 (≠ Q119), P130 (≠ N138), E131 (≠ G139), P138 (= P149), G139 (≠ M150), M140 (≠ V151)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
31% identity, 98% coverage: 3:262/264 of query aligns to 4:255/255 of 3q0gC
- active site: A65 (≠ H65), M70 (= M70), T80 (≠ K85), F84 (= F88), G108 (≠ A116), E111 (≠ Q119), P130 (≠ N138), E131 (≠ G139), V136 (≠ L144), P138 (= P149), G139 (≠ M150), L224 (≠ A231), F234 (≠ M241)
- binding coenzyme a: L25 (= L25), A63 (= A63), I67 (≠ L67), K68 (= K68), Y104 (≠ I112), P130 (≠ N138), E131 (≠ G139), L134 (≠ I142)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
31% identity, 98% coverage: 3:262/264 of query aligns to 3:254/256 of 3h81A
- active site: A64 (≠ H65), M69 (= M70), T79 (≠ K85), F83 (= F88), G107 (≠ A116), E110 (≠ Q119), P129 (≠ N138), E130 (≠ G139), V135 (≠ L144), P137 (= P149), G138 (≠ M150), L223 (≠ A231), F233 (≠ M241)
- binding calcium ion: F233 (≠ M241), Q238 (≠ T246)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 94% coverage: 17:263/264 of query aligns to 21:265/266 of O53561
- K135 (≠ R134) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 134:141, 25% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ N141) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 95% coverage: 12:262/264 of query aligns to 85:331/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
6n97A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- amino(dethia)-coa (see paper)
28% identity, 95% coverage: 12:261/264 of query aligns to 11:257/260 of 6n97A
- active site: H65 (= H65), L70 (≠ M70), G109 (≠ A116), E112 (≠ Q119), P132 (≠ G139), V137 (≠ L144), Y139 (≠ C146), E227 (≠ V238), Y237 (vs. gap)
- binding (2R)-sulfonatepropionyl-amino(dethia)-CoA: L24 (= L25), K59 (≠ R59), A63 (= A63), H65 (= H65), D66 (= D66), I67 (≠ L67), W107 (≠ T114), G108 (≠ A115), G109 (≠ A116), T131 (≠ N138), P132 (≠ G139), L135 (≠ I142), Y139 (≠ C146), F249 (= F253), K252 (= K256)
- binding (2S)-sulfonatepropionyl-amino(dethia)-CoA: L24 (= L25), K59 (≠ R59), A63 (= A63), H65 (= H65), D66 (= D66), I67 (≠ L67), W107 (≠ T114), G108 (≠ A115), G109 (≠ A116), T131 (≠ N138), P132 (≠ G139), L135 (≠ I142), Y139 (≠ C146), F249 (= F253), K252 (= K256)
6n96A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- oxa(dethia)-coa (see paper)
28% identity, 95% coverage: 12:261/264 of query aligns to 11:257/260 of 6n96A
- active site: H65 (= H65), L70 (≠ M70), G109 (≠ A116), E112 (≠ Q119), P132 (≠ G139), V137 (≠ L144), Y139 (≠ C146), E227 (≠ V238), Y237 (vs. gap)
- binding (2~{S})-1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propane-2-sulfonic acid: K59 (≠ R59), A63 (= A63), H65 (= H65), D66 (= D66), I67 (≠ L67), H68 (≠ K68), W107 (≠ T114), G108 (≠ A115), G109 (≠ A116), T131 (≠ N138), P132 (≠ G139), L135 (≠ I142), V137 (≠ L144), Y139 (≠ C146), F249 (= F253), K252 (= K256)
- binding (2~{R})-1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propane-2-sulfonic acid: K59 (≠ R59), A63 (= A63), H65 (= H65), D66 (= D66), I67 (≠ L67), H68 (≠ K68), W107 (≠ T114), G108 (≠ A115), G109 (≠ A116), T131 (≠ N138), P132 (≠ G139), L135 (≠ I142), V137 (≠ L144), Y139 (≠ C146), F249 (= F253), K252 (= K256)
6n95A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- coa (see paper)
28% identity, 95% coverage: 12:261/264 of query aligns to 11:257/260 of 6n95A
- active site: H65 (= H65), L70 (≠ M70), G109 (≠ A116), E112 (≠ Q119), P132 (≠ G139), V137 (≠ L144), Y139 (≠ C146), E227 (≠ V238), Y237 (vs. gap)
- binding (2R)-sulfonatepropionyl-CoA: K23 (≠ S24), L24 (= L25), K59 (≠ R59), A63 (= A63), H65 (= H65), D66 (= D66), I67 (≠ L67), H68 (≠ K68), W107 (≠ T114), G108 (≠ A115), G109 (≠ A116), T131 (≠ N138), P132 (≠ G139), L135 (≠ I142), Y139 (≠ C146), F249 (= F253), K252 (= K256)
- binding (2S)-sulfonatepropionyl-CoA: K23 (≠ S24), L24 (= L25), K59 (≠ R59), A63 (= A63), H65 (= H65), D66 (= D66), I67 (≠ L67), H68 (≠ K68), W107 (≠ T114), G108 (≠ A115), G109 (≠ A116), T131 (≠ N138), P132 (≠ G139), L135 (≠ I142), V137 (≠ L144), Y139 (≠ C146), F249 (= F253), K252 (= K256)
6n94A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- amino(dethia)-coa (see paper)
28% identity, 95% coverage: 12:261/264 of query aligns to 11:257/260 of 6n94A
- active site: H65 (= H65), L70 (≠ M70), G109 (≠ A116), E112 (≠ Q119), P132 (≠ G139), V137 (≠ L144), Y139 (≠ C146), E227 (≠ V238), Y237 (vs. gap)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylamino]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: K23 (≠ S24), L24 (= L25), A63 (= A63), H65 (= H65), D66 (= D66), I67 (≠ L67), H68 (≠ K68), W107 (≠ T114), G108 (≠ A115), G109 (≠ A116), T131 (≠ N138), P132 (≠ G139), Y139 (≠ C146)
6n93A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- oxa(dethia)-coa (see paper)
28% identity, 95% coverage: 12:261/264 of query aligns to 11:257/260 of 6n93A
- active site: H65 (= H65), L70 (≠ M70), G109 (≠ A116), E112 (≠ Q119), P132 (≠ G139), V137 (≠ L144), Y139 (≠ C146), E227 (≠ V238), Y237 (vs. gap)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: L24 (= L25), A63 (= A63), H65 (= H65), D66 (= D66), I67 (≠ L67), H68 (≠ K68), W107 (≠ T114), T131 (≠ N138), L135 (≠ I142), F249 (= F253), K252 (= K256)
Query Sequence
>3608199 FitnessBrowser__Dino:3608199
MAEDLLLRSDADGIATLTLNAPQSLNVLSDAMLAALQAQIDTLAEDRTTRVVVLRGAGRA
FCAGHDLKEMTAARQSEDGGAAAFKDLFDRCARMMMGLQALPQPVIAQVHGIATAAGCQL
VATADMAVAAEGARFGVNGVNIGLFCSTPMVALSRNIPRKQAFELLTTGEMIEAQKAQAL
GLVNRVVPTEDLEAETNALATKVAEKRGAVVAIGKRAFYEQSQMSLADAYAFTGNVMVKN
MALRDTEEGIAAFLDKRPPNWSDG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory