SitesBLAST
Comparing 3608216 FitnessBrowser__Dino:3608216 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
41% identity, 98% coverage: 1:311/316 of query aligns to 1:308/309 of 3uqdB
- active site: G253 (= G257), A254 (= A258), G255 (= G259), D256 (= D260)
- binding adenosine-5'-diphosphate: K185 (≠ R188), N187 (≠ D190), S224 (≠ A227), G226 (= G229), P227 (≠ A230), G229 (= G232), S248 (≠ V252), M258 (≠ F262), V280 (= V284), G283 (≠ A287), S284 (≠ A288)
- binding adenosine-5'-triphosphate: Y23 (≠ A23), K27 (= K27)
- binding 6-O-phosphono-beta-D-fructofuranose: K27 (= K27), R29 (= R29)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: D14 (= D14), G39 (= G39), N43 (= N43), R90 (= R90), R105 (= R105), S139 (= S140), G253 (= G257)
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
41% identity, 98% coverage: 1:311/316 of query aligns to 1:308/309 of 3uqdA
- active site: G253 (= G257), A254 (= A258), G255 (= G259), D256 (= D260)
- binding adenosine-5'-triphosphate: K185 (≠ R188), S224 (≠ A227), G226 (= G229), P227 (≠ A230), G229 (= G232), T251 (≠ K255), G255 (= G259), M258 (≠ F262), V280 (= V284), G283 (≠ A287), S284 (≠ A288), T287 (≠ V291)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), G38 (= G38), G39 (= G39), N43 (= N43), R90 (= R90), S139 (= S140), D256 (= D260)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: K27 (= K27), R29 (= R29)
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
41% identity, 98% coverage: 1:311/316 of query aligns to 1:308/309 of 3n1cA
- active site: G253 (= G257), A254 (= A258), G255 (= G259), D256 (= D260)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), K27 (= K27), R29 (= R29), G39 (= G39), N43 (= N43), R90 (= R90), G138 (= G139), S139 (= S140), D256 (= D260)
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 98% coverage: 1:311/316 of query aligns to 1:308/309 of P06999
- K27 (= K27) binding ; binding
- KPN 185:187 (≠ RMD 188:190) binding in other chain
- NQK 187:189 (≠ DLE 190:192) binding in other chain
- E190 (= E193) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ AKGAEG 227:232) binding in other chain
- S248 (≠ V252) binding in other chain
- S250 (= S254) binding
- V252 (≠ T256) binding
- V280 (= V284) binding in other chain
- S284 (≠ A288) binding in other chain
- A286 (= A290) binding
- N289 (≠ T293) binding
- G291 (≠ D295) binding
- R293 (≠ D297) binding
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
41% identity, 98% coverage: 1:311/316 of query aligns to 1:306/307 of 3uqeA
- active site: G253 (= G257), A254 (= A258), G255 (= G259), D256 (= D260)
- binding adenosine-5'-triphosphate: K185 (≠ R188), N187 (≠ D190), S224 (≠ A227), G226 (= G229), P227 (≠ A230), G229 (= G232), S248 (≠ V252), A254 (= A258), G255 (= G259), M258 (≠ F262), V280 (≠ A286), G283 (≠ S289), S284 (≠ A290), T287 (= T293)
- binding pyrophosphate 2-: N187 (≠ D190), K189 (≠ E192)
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
41% identity, 98% coverage: 1:311/316 of query aligns to 1:303/304 of 3cqdA
- active site: G253 (= G257), A254 (= A258), G255 (= G259), D256 (= D260)
- binding adenosine-5'-triphosphate: Y23 (≠ A23), G26 (≠ L26), K27 (= K27), K185 (≠ R188), N187 (≠ D190), N187 (≠ D190), K189 (≠ E192), S224 (≠ A227), G226 (= G229), P227 (≠ A230), G229 (= G232), S248 (≠ V252), T251 (≠ K255), A254 (= A258), G255 (= G259), M258 (≠ F262), V280 (≠ G285), G283 (≠ A288), S284 (= S289), T287 (= T292)
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 98% coverage: 3:311/316 of query aligns to 13:316/339 of P9WID3
- K283 (≠ E278) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
27% identity, 99% coverage: 4:316/316 of query aligns to 3:312/319 of 2f02A
- binding adenosine-5'-triphosphate: N186 (≠ D190), S224 (≠ A227), G226 (= G229), I243 (≠ P247), I246 (≠ V250), G253 (= G257), S254 (≠ A258), G255 (= G259), T258 (≠ F262), M280 (≠ V284), G283 (≠ A287), M284 (≠ A288)
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
28% identity, 94% coverage: 4:300/316 of query aligns to 3:303/320 of 2ajrA
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
28% identity, 86% coverage: 4:276/316 of query aligns to 6:274/314 of 2jgvB
Sites not aligning to the query:
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
27% identity, 86% coverage: 4:276/316 of query aligns to 10:278/318 of 2jg1A
- active site: G259 (= G257), S260 (≠ A258), G261 (= G259), D262 (= D260)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (≠ G40), N193 (≠ D190), S230 (≠ A227), G232 (= G229), G235 (= G232), I252 (≠ V250), V254 (= V252), G259 (= G257), S260 (≠ A258), G261 (= G259), D262 (= D260), T264 (≠ F262)
Sites not aligning to the query:
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
27% identity, 86% coverage: 4:276/316 of query aligns to 7:275/315 of 2jg1C
- active site: G256 (= G257), S257 (≠ A258), G258 (= G259), D259 (= D260)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (≠ A227), G229 (= G229), A230 (= A230), G232 (= G232), I246 (≠ P247), I249 (≠ V250), V251 (= V252), V255 (≠ T256), G256 (= G257), S257 (≠ A258), G258 (= G259), D259 (= D260), T261 (≠ F262)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D14), G42 (= G39), K43 (≠ G40), R93 (= R90), C95 (≠ N92), L108 (≠ I107), G140 (= G139), S141 (= S140), D259 (= D260)
Sites not aligning to the query:
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
26% identity, 99% coverage: 4:316/316 of query aligns to 3:308/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (≠ K182), S220 (≠ A227), G222 (= G229), A223 (= A230), G225 (= G232), V242 (= V250), G249 (= G257), A250 (= A258), G251 (= G259), D252 (= D260), S279 (≠ A287), V283 (= V291)
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
27% identity, 91% coverage: 4:291/316 of query aligns to 3:276/298 of 3julA
P0DX97 Deoxyribokinase; dRK; ATP:2-deoxy-D-ribose 5-phosphotransferase; EC 2.7.1.229 from Salmonella typhi (see paper)
38% identity, 32% coverage: 193:292/316 of query aligns to 187:284/306 of P0DX97
Sites not aligning to the query:
- 10 Important for substrate specificity; M→N: 2.5-fold decrease in Vmax for deoxyribokinase activity and 70-fold increase in KM for deoxyribose. 2-fold increase in KM for ribose.
6wb7A Acarbose kinase acbk as a complex with acarbose and amp-pnp (see paper)
29% identity, 84% coverage: 33:296/316 of query aligns to 37:282/296 of 6wb7A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: Q41 (≠ G39), T42 (≠ G40), N97 (≠ S94), S107 (≠ M108), W109 (≠ G110), H162 (≠ D167), N163 (≠ T168), D246 (= D260)
- binding phosphoaminophosphonic acid-adenylate ester: T210 (≠ A227), G212 (= G229), G215 (= G232), Y229 (≠ W243), G243 (= G257), A244 (= A258), G245 (= G259), D246 (= D260), C277 (≠ V291)
- binding alpha-D-glucopyranose: G111 (≠ T112), E114 (≠ D115), I139 (≠ S140), F171 (= F176)
Sites not aligning to the query:
6wb7C Acarbose kinase acbk as a complex with acarbose and amp-pnp (see paper)
29% identity, 84% coverage: 33:296/316 of query aligns to 36:281/293 of 6wb7C
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: Q40 (≠ G39), T41 (≠ G40), N96 (≠ S94), S106 (≠ M108), W108 (≠ G110), H161 (≠ D167), N162 (≠ T168), D245 (= D260)
- binding phosphoaminophosphonic acid-adenylate ester: T209 (≠ A227), G211 (= G229), G214 (= G232), Y228 (≠ W243), V231 (≠ R246), P233 (= P248), N241 (≠ T256), G242 (= G257), A243 (= A258), G244 (= G259), D245 (= D260), A269 (≠ V284), C276 (≠ V291)
- binding alpha-D-glucopyranose: G110 (≠ T112), E113 (≠ D115), I138 (≠ S140), F170 (= F176)
- binding manganese (ii) ion: D199 (= D217), G201 (= G219)
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 16% coverage: 223:274/316 of query aligns to 216:266/319 of Q8ZKR2
- D246 (≠ S254) binding
- T248 (= T256) binding
- D252 (= D260) binding
Sites not aligning to the query:
- 16 binding
- 31 binding
- 101 binding
- 162 binding
- 180 binding
- 181 binding
- 183 binding
- 213 binding
- 287 binding
- 290 binding
- 292 binding
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
40% identity, 16% coverage: 223:274/316 of query aligns to 205:255/297 of 1tz6A
Sites not aligning to the query:
- active site: 24, 88
- binding phosphomethylphosphonic acid adenylate ester: 149, 176, 181, 270, 273, 274
- binding 5-aminoimidazole ribonucleoside: 8, 12, 27, 88, 90, 151, 154
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
40% identity, 16% coverage: 223:274/316 of query aligns to 205:255/299 of 1tz3A
Sites not aligning to the query:
Query Sequence
>3608216 FitnessBrowser__Dino:3608216
MTRIVTLTLNPALDSSTDAEHVAPDLKLRCSAPRADAGGGGVNVSRAIAFLGGQSLAALA
LGGGPGERVRQLLRVEGIPVHDLGVAVETRQNLSVIARDTGAQYRFIMPGQTWTDVDVDR
SCEALCKLARAGDLIVPSGSLPPGVGPGDLVALTNRLAVLGVRIVLDTSGAALQAFATGR
AKTLHVLRMDLEEAQSLAGRDLDTVADVAQFGRELVDAGAAKSVIVAKGAEGSILVTSRG
QGWHVRPPKVNVVSKTGAGDSFVAGFTLALAQGSSDLEATVRGVGAAASAVTTPDTDLCD
GASAERYAALSTVTEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory