Comparing 3608248 FitnessBrowser__Dino:3608248 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
27% identity, 47% coverage: 119:330/452 of query aligns to 73:263/390 of 3oo6A
Sites not aligning to the query:
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
21% identity, 47% coverage: 52:264/452 of query aligns to 2:210/392 of 2b3fA
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
21% identity, 47% coverage: 52:264/452 of query aligns to 2:210/392 of 2b3bC
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
21% identity, 47% coverage: 52:264/452 of query aligns to 2:210/392 of 2b3bA
Sites not aligning to the query:
6preA Sbp rafe in complex with verbascose (see paper)
23% identity, 74% coverage: 100:432/452 of query aligns to 53:359/386 of 6preA
Sites not aligning to the query:
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
23% identity, 74% coverage: 100:432/452 of query aligns to 52:358/385 of 2i58A
Sites not aligning to the query:
>3608248 FitnessBrowser__Dino:3608248
MRHTLHASAAALALSAGMAGAGGHLAFTPGEGEFNWDSYQAFAEATDLSGQDLSIFGPWL
AGEADAFSNLVAFFNEATGANATYVGSDSLEQQIVIDAEAGSAPDLTVFPQPGLATTMAA
RGFLTPLPDGTDDWLRENYAAGQSWIDLGTYADGSGNDQLYGFFFNVNVKSLVWYIPENF
EDFDYEVPETMEEFKALMDQMVEDGQTPLCVGLGSGGATGWPATDWVEDLMLRTQPPEVY
DAWVSNEMPFDDPRVVAAIEEYGSFTRNDDYVVGNANDTASVDFRESPLGLFASPPACMM
HRQASFIPAYFPEGTELGEDADFFYFPAFEEKDLGRPVLGAGTLFAITNENPAASAFIEF
LKTPFAHEIMMAQDGFLTPFKGANPAAYASDTLRGQGEILTNATTFRFDGSDLMPGGVGA
GTFWTGMVDYSSGAKSAADVASEIQASWESLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory