SitesBLAST
Comparing 3608250 FitnessBrowser__Dino:3608250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2wc3A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine (see paper)
44% identity, 97% coverage: 6:425/435 of query aligns to 3:428/442 of 2wc3A
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (≠ C170), N292 (= N292), Y294 (= Y294), E348 (= E351)
- binding (3Z,5S,6R,7S,8S,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q19 (= Q22), H120 (= H122), N164 (= N166), E165 (= E167), Y294 (= Y294), H297 (≠ K297), W321 (= W323), E348 (= E351), W395 (= W392), E402 (= E399), W403 (= W400), F411 (= F408)
1oinA Family 1 b-glucosidase from thermotoga maritima (see paper)
44% identity, 97% coverage: 6:425/435 of query aligns to 3:428/442 of 1oinA
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (≠ C170), N292 (= N292), Y294 (= Y294), E348 (= E351)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q22), H120 (= H122), N164 (= N166), E165 (= E167), Y294 (= Y294), E348 (= E351), W395 (= W392), E402 (= E399), W403 (= W400)
5ossB Beta-glucosidase from thermotoga maritima in complex with gluco-1h- imidazole (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:429/443 of 5ossB
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N291 (= N292), Y293 (= Y294), E349 (= E351)
- binding (4~{S},5~{S},6~{R},7~{R})-7-(hydroxymethyl)-4,5,6,7-tetrahydro-1~{H}-benzimidazole-4,5,6-triol: Q18 (= Q22), H119 (= H122), E164 (= E167), Y293 (= Y294), E349 (= E351), W396 (= W392), E403 (= E399), W404 (= W400), F412 (= F408)
5n6tA Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:429/443 of 5n6tA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N291 (= N292), Y293 (= Y294), E349 (= E351)
- binding [(1~{R},2~{R},3~{R},4~{S},5~{R},6~{S})-3,4,5-tris(oxidanyl)-7-oxabicyclo[4.1.0]heptan-2-yl]methanediazonium: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y294), E349 (= E351), W396 (= W392), E403 (= E399), W404 (= W400), F412 (= F408)
5n6sA Thermotoga maritima family 1 glycoside hydrolase complexed with carba- cyclophellitol transition state mimic (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:429/443 of 5n6sA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N291 (= N292), Y293 (= Y294), E349 (= E351)
- binding azanylidene-[4-[[(1~{S},2~{R},3~{R},4~{R},5~{S},6~{S},7~{S})-2-(hydroxymethyl)-3,4,5-tris(oxidanyl)-7-bicyclo[4.1.0]heptanyl]carbonylamino]butylimino]azanium: Q18 (= Q22), H119 (= H122), W120 (= W123), N163 (= N166), E164 (= E167), W166 (= W169), V167 (≠ C170), E349 (= E351), W396 (= W392), E403 (= E399), W404 (= W400), F412 (= F408)
2wc4A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:429/443 of 2wc4A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N291 (= N292), Y293 (= Y294), E349 (= E351)
- binding (3Z,5S,6R,7S,8R,8aS)-3-(octylimino)hexahydro[1,3]thiazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y294), W322 (= W323), E349 (= E351), W396 (= W392), E403 (= E399), W404 (= W400), F412 (= F408)
2wbgA Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:429/443 of 2wbgA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N291 (= N292), Y293 (= Y294), E349 (= E351)
- binding (3Z,5S,6R,7S,8R,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y294), H296 (≠ K297), W322 (= W323), E349 (= E351), W396 (= W392), E403 (= E399), W404 (= W400)
2jalB Beta-glucosidase from thermotoga maritima in complex with cyclophellitol (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 3:430/444 of 2jalB
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (≠ C170), N292 (= N292), Y294 (= Y294), E350 (= E351)
- binding calcium ion: D277 (= D277), E281 (≠ T281)
- binding (1r,2s,3s,4s,5r,6r)-6-(hydroxymethyl)cyclohexane-1,2,3,4,5-pentol: Q19 (= Q22), H120 (= H122), E165 (= E167), E350 (= E351), W397 (= W392), E404 (= E399), W405 (= W400), F413 (= F408)
1w3jA Family 1 b-glucosidase from thermotoga maritima in complex with tetrahydrooxazine (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 1:428/443 of 1w3jA
- active site: R74 (= R78), H118 (= H122), E163 (= E167), V166 (≠ C170), N290 (= N292), Y292 (= Y294), E348 (= E351)
- binding tetrahydrooxazine: Q17 (= Q22), H118 (= H122), E163 (= E167), Y292 (= Y294), E348 (= E351), W395 (= W392), E402 (= E399), W403 (= W400)
1oifA Family 1 b-glucosidase from thermotoga maritima (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:429/444 of 1oifA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N291 (= N292), Y293 (= Y294), E349 (= E351)
- binding 5-hydroxymethyl-3,4-dihydroxypiperidine: Q18 (= Q22), E164 (= E167), Y293 (= Y294), E349 (= E351), W396 (= W392), E403 (= E399), W404 (= W400), F412 (= F408)
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
44% identity, 97% coverage: 6:425/435 of query aligns to 2:426/440 of 2cesA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N291 (= N292), Y293 (= Y294), E346 (= E351)
- binding glucoimidazole: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y294), E346 (= E351), W393 (= W392), E400 (= E399), W401 (= W400), F409 (= F408)
2cbvA Beta-glucosidase from thermotoga maritima in complex with calystegine b2 (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:428/443 of 2cbvA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N290 (= N292), Y292 (= Y294), E348 (= E351)
- binding calystegine b2: Q18 (= Q22), H119 (= H122), W120 (= W123), N163 (= N166), E164 (= E167), E348 (= E351), W395 (= W392), E402 (= E399), W403 (= W400)
1oimA Family 1 b-glucosidase from thermotoga maritima (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:428/443 of 1oimA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N290 (= N292), Y292 (= Y294), E348 (= E351)
- binding 1-deoxynojirimycin: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y292 (= Y294), E348 (= E351), W395 (= W392), E402 (= E399), W403 (= W400)
2j78A Beta-glucosidase from thermotoga maritima in complex with gluco- hydroximolactam (see paper)
44% identity, 97% coverage: 6:425/435 of query aligns to 2:428/443 of 2j78A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N291 (= N292), Y293 (= Y294), E348 (= E351)
- binding calcium ion: E64 (≠ D67), E67 (≠ A70), D276 (= D277), S279 (≠ D280)
- binding (2s,3s,4r,5r)-6-(hydroxyamino)-2-(hydroxymethyl)-2,3,4,5-tetrahydropyridine-3,4,5-triol: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y294), E348 (= E351), W395 (= W392), E402 (= E399), W403 (= W400), F411 (= F408)
1uz1A Family 1 b-glucosidase from thermotoga maritima in complex with isofagomine lactam (see paper)
44% identity, 97% coverage: 6:425/435 of query aligns to 2:425/439 of 1uz1A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N290 (= N292), Y292 (= Y294), E345 (= E351)
- binding (3s,4r,5r)-3,4-dihydroxy-5-(hydroxymethyl)piperidin-2-one: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y292 (= Y294), E345 (= E351), W392 (= W392), E399 (= E399), W400 (= W400), F408 (= F408)
2vrjA Beta-glucosidase from thermotoga maritima in complex with n-octyl-5- deoxy-6-oxa-n-(thio)carbamoylcalystegine (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:424/438 of 2vrjA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N288 (= N292), Y290 (= Y294), E344 (= E351)
- binding calcium ion: H38 (≠ A41), D50 (≠ A53)
- binding (1S,2R,3S,4R,5R)-2,3,4-trihydroxy-N-octyl-6-oxa-8-azabicyclo[3.2.1]octane-8-carbothioamide: Q18 (= Q22), H119 (= H122), E164 (= E167), H178 (= H181), Y290 (= Y294), E344 (= E351), W391 (= W392), E398 (= E399), W399 (= W400), A400 (≠ S401), E401 (≠ F402)
2j7gA Beta-glucosidase from thermotoga maritima in complex with methyl acetic acid-substituted glucoimidazole (see paper)
44% identity, 97% coverage: 6:425/435 of query aligns to 2:423/437 of 2j7gA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N288 (= N292), Y290 (= Y294), E343 (= E351)
- binding methyl acetic acid-substituted glucoimidazole: Q18 (= Q22), H119 (= H122), E164 (= E167), Y290 (= Y294), E343 (= E351), W390 (= W392), E397 (= E399), W398 (= W400), F406 (= F408)
2j75A Beta-glucosidase from thermotoga maritima in complex with noeuromycin (see paper)
43% identity, 97% coverage: 6:425/435 of query aligns to 2:424/438 of 2j75A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N288 (= N292), Y290 (= Y294), E344 (= E351)
- binding (2r,3s,4r,5r)-5-(hydroxymethyl)piperidine-2,3,4-triol: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y290 (= Y294), E344 (= E351), W391 (= W392), E398 (= E399), W399 (= W400), F407 (= F408)
2j79A Beta-glucosidase from thermotoga maritima in complex with galacto- hydroximolactam (see paper)
44% identity, 97% coverage: 6:425/435 of query aligns to 2:423/437 of 2j79A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N288 (= N292), Y290 (= Y294), E343 (= E351)
- binding (2e,3r,4r,5r,6s)-3,4,5-trihydroxy-6-(hydroxymethyl)-2-piperidinone: Q18 (= Q22), H119 (= H122), E164 (= E167), Y290 (= Y294), E343 (= E351), W390 (= W392), E397 (= E399), W398 (= W400), F406 (= F408)
2cbuA Beta-glucosidase from thermotoga maritima in complex with castanospermine (see paper)
44% identity, 97% coverage: 6:425/435 of query aligns to 2:425/440 of 2cbuA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (≠ C170), N289 (= N292), Y291 (= Y294), E345 (= E351)
- binding castanospermine: Q18 (= Q22), H119 (= H122), N163 (= N166), E164 (= E167), Y291 (= Y294), W318 (= W323), E345 (= E351), W392 (= W392), E399 (= E399), W400 (= W400), F408 (= F408)
Query Sequence
>3608250 FitnessBrowser__Dino:3608250
MSFDRNTYPDGFLFGVATSAYQIEGHGQGGAGRTHWDDFSATPGNVARAEHGARACGHLD
RLEEDLDLIAGLGVDAYRFSTSWARVLPEGRGAPNMEGLDFYDRLVDGLLARGIKPAATL
YHWELPSALADLGGWRNRDIASWFGDFTDTIMDRIGDRVWSAAPINEPWCVGWLSHFQGH
HAPGLRDIRATARAMHHILLAHGTAIARMRDMGMRNLGAVVNMEYAQPLDDSPTAMAAAE
LYDAIYNQFFLSGMFHNTYPEPVLAGLAPHLPDRWQDDFDTIATPLDWVGLNYYTRKIIG
PGDSPWPAYREIDGPLPKTQMGWEVFPEGLHALLTMMQARFTGDLPIYITENGMASALPV
NDADRLAYLDAHLAQVRRAIADGVPVDGYFIWSLMDNYEWSFGYEKRFGLVHVDFDTLVR
TPKASYRALASALNR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory