Comparing 3608251 FitnessBrowser__Dino:3608251 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
30% identity, 96% coverage: 9:319/323 of query aligns to 4:314/320 of 1sz2B
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
29% identity, 79% coverage: 13:266/323 of query aligns to 30:318/374 of 8dtcA
6vzzA Crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose (see paper)
28% identity, 79% coverage: 13:266/323 of query aligns to 30:319/374 of 6vzzA
2q2rA Trypanosoma cruzi glucokinase in complex with beta-d-glucose and adp (see paper)
25% identity, 79% coverage: 6:259/323 of query aligns to 27:303/370 of 2q2rA
Sites not aligning to the query:
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 74% coverage: 13:252/323 of query aligns to 10:245/306 of 7p7wBBB
Sites not aligning to the query:
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 74% coverage: 13:252/323 of query aligns to 7:242/303 of 7p9lAAA
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 74% coverage: 13:252/323 of query aligns to 8:243/304 of 7p9pAAA
Sites not aligning to the query:
>3608251 FitnessBrowser__Dino:3608251
MTSLRDAPALVADIGGTNTRVALADGPVLRAGSVEKYRNADYSSLDSVLRSYLEKMEVAG
CSGACVALAGPVRNGIGHLTNLDWRMDEDLLSEATGAPVVALLNDLQAQGFALGHLEAAC
LRPVISRPPPAAQETRLMIGLGTGFNAASVLYTPAGRIVTPSEAGHANLPVRTEQELRLC
RFVETAHGFPAVEDVLSGRGLERVYNFLSPTPDQPQRLSAAEVMAAAAREERQALDALEL
FIGLLGTVAGNLSLIHLPFGGVYLCGGVARHIGPYLGSMGFAEAFANKGRFADFMRDFPV
WLVEDDFAALTGCASFLDERCRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory