SitesBLAST
Comparing 3608263 FitnessBrowser__Dino:3608263 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
31% identity, 45% coverage: 4:371/810 of query aligns to 2:347/359 of Q8U1K9
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
31% identity, 46% coverage: 3:371/810 of query aligns to 1:342/346 of 1xhcA
- active site: P10 (≠ M12), K38 (≠ R44), P39 (≠ I45), F145 (≠ L153), E149 (= E157), M276 (≠ Y291)
- binding flavin-adenine dinucleotide: V6 (≠ I8), G7 (= G9), G9 (= G11), P10 (≠ M12), G11 (≠ A13), D29 (≠ N35), K30 (≠ A36), K38 (≠ R44), P39 (≠ I45), E74 (≠ H80), A75 (≠ V81), A100 (= A106), T101 (= T107), G102 (= G108), L119 (≠ Y127), R120 (= R128), F145 (≠ L153), I146 (≠ L154), E149 (= E157), G259 (= G274), D260 (≠ E275), G270 (= G285), T271 (≠ L286), A272 (≠ V287)
3kljA Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum (see paper)
30% identity, 45% coverage: 4:368/810 of query aligns to 4:349/378 of 3kljA
- active site: P12 (≠ M12), R41 (= R44), P42 (≠ I45), N274 (≠ Y291)
- binding flavin-adenine dinucleotide: L8 (≠ I8), G9 (= G9), G11 (= G11), P12 (≠ M12), A13 (= A13), N32 (= N35), S33 (≠ A36), E34 (= E37), R41 (= R44), P42 (≠ I45), F77 (≠ H80), A78 (≠ V81), S105 (≠ T107), G106 (= G108), L123 (≠ Y127), Y124 (≠ R128), L150 (= L154), G257 (= G274), D258 (≠ E275), G268 (= G285), L269 (= L286), I270 (≠ V287), A273 (≠ L290), K301 (= K318)
Q9AL95 NADH-rubredoxin oxidoreductase; NROR; NADH:rubredoxin oxidoreductase; EC 1.18.1.1 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
30% identity, 45% coverage: 4:368/810 of query aligns to 5:350/379 of Q9AL95
- C26 (≠ D25) modified: Disulfide link with 286
- NSE 33:35 (≠ NAE 35:37) binding
- R42 (= R44) binding
- A79 (≠ V81) binding
- Y125 (≠ R128) binding
- C137 (≠ A140) modified: Disulfide link with 216
- C216 (≠ L232) modified: Disulfide link with 137
- D259 (≠ E275) binding
- C286 (≠ L302) modified: Disulfide link with 26
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
32% identity, 43% coverage: 84:430/810 of query aligns to 89:468/541 of 6pfzA
- active site: L455 (≠ E417), F456 (≠ I418)
- binding calcium ion: D306 (= D292), T332 (≠ S314), D427 (vs. gap), L428 (= L391)
- binding coenzyme a: R313 (= R295), Y430 (≠ F393), V447 (≠ L412)
- binding flavin-adenine dinucleotide: A115 (= A106), T116 (= T107), G117 (= G108), L136 (≠ Y127), G286 (= G274), D287 (≠ E275), P303 (= P289), F304 (≠ L290), G305 (≠ Y291)
Sites not aligning to the query:
- active site: 37, 42
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
30% identity, 48% coverage: 6:395/810 of query aligns to 4:405/424 of 8c0zE
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
31% identity, 40% coverage: 2:325/810 of query aligns to 1:324/381 of 2v3aA
- active site: L11 (≠ M12), K42 (≠ R44), P43 (≠ I45), M290 (≠ Y291)
- binding flavin-adenine dinucleotide: I7 (= I8), G8 (= G9), T9 (≠ A10), G10 (= G11), A12 (= A13), T33 (≠ N35), A34 (= A36), D35 (≠ E37), K42 (≠ R44), P43 (≠ I45), R79 (vs. gap), V80 (= V81), A105 (= A106), W106 (≠ T107), G107 (= G108), I153 (≠ L154), F157 (≠ A158), D274 (≠ E275), L284 (≠ G285), Y285 (≠ L286), V286 (= V287), K317 (= K318)
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 40% coverage: 2:325/810 of query aligns to 4:327/384 of Q9HTK9
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
30% identity, 35% coverage: 19:303/810 of query aligns to 56:313/539 of 8a56B
- binding flavin-adenine dinucleotide: V80 (≠ R44), S109 (≠ A106), P110 (≠ T107), G111 (= G108), I159 (≠ L154), G278 (= G274), D279 (≠ E275), S295 (≠ G285), L296 (= L286), A297 (≠ V287)
- binding 3'-phosphate-adenosine-5'-diphosphate: F70 (= F34), R305 (= R295)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 6, 7, 9, 11, 32, 33, 42, 422, 423
- binding 3'-phosphate-adenosine-5'-diphosphate: 17, 18, 21, 356, 430, 435, 438, 505, 506, 509
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
32% identity, 34% coverage: 30:308/810 of query aligns to 28:342/565 of 3nt6A
- active site: V38 (≠ N43), N42 (≠ L47), S43 (= S48), N325 (≠ Y291)
- binding coenzyme a: S39 (≠ R44), N42 (≠ L47), S43 (= S48), A321 (≠ V287), N325 (≠ Y291), R329 (= R295)
- binding flavin-adenine dinucleotide: E33 (≠ N35), R34 (= R39), N42 (≠ L47), S43 (= S48), E80 (≠ H80), V81 (= V81), S112 (≠ A106), P113 (≠ T107), G114 (= G108), L133 (≠ Y127), R134 (= R128), F161 (≠ L153), G302 (= G274), D303 (≠ E275), P319 (≠ G285), L320 (= L286), A321 (≠ V287)
Sites not aligning to the query:
- active site: 11, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
30% identity, 38% coverage: 23:331/810 of query aligns to 23:335/443 of 6rvhA
- active site: V39 (≠ G40), C44 (≠ I45), E53 (≠ D54), E58 (≠ D59), Y159 (≠ L153), E163 (= E157)
- binding coenzyme a: R23 (≠ K23), S40 (≠ N41), Y41 (= Y42), C44 (≠ I45), R63 (≠ H63), N303 (vs. gap), R307 (= R295)
- binding flavin-adenine dinucleotide: E34 (≠ N35), K35 (≠ A36), A43 (≠ R44), C44 (≠ I45), V81 (= V81), T113 (= T107), G114 (= G108), R134 (= R128), Y159 (≠ L153), G280 (= G274), D281 (≠ E275), P297 (= P289), L298 (= L290), G299 (≠ Y291)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 20, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
30% identity, 38% coverage: 23:331/810 of query aligns to 23:335/443 of 6rvbA
- active site: V39 (≠ G40), C44 (≠ I45), E53 (≠ D54), E58 (≠ D59), Y159 (≠ L153), E163 (= E157)
- binding coenzyme a: R23 (≠ K23), S40 (≠ N41), Y41 (= Y42), C44 (≠ I45), R63 (≠ H63), N303 (vs. gap), R307 (= R295)
- binding flavin-adenine dinucleotide: Y33 (≠ F34), E34 (≠ N35), K35 (≠ A36), S36 (≠ E37), A43 (≠ R44), C44 (≠ I45), E80 (≠ H80), V81 (= V81), T113 (= T107), G114 (= G108), L133 (≠ Y127), R134 (= R128), I160 (≠ L154), G280 (= G274), D281 (≠ E275), L298 (= L290), G299 (≠ Y291)
- binding nicotinamide-adenine-dinucleotide: G156 (= G150), G158 (= G152), Y159 (≠ L153), I160 (≠ L154), E179 (≠ H173), A180 (≠ L174), A240 (= A236), T241 (≠ V237), G242 (= G238), P297 (= P289), I328 (≠ L324), F329 (= F325)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 20, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
30% identity, 38% coverage: 23:331/810 of query aligns to 23:335/443 of 6ruzA
- active site: V39 (≠ G40), C44 (≠ I45), E53 (≠ D54), E58 (≠ D59), Y159 (≠ L153), E163 (= E157)
- binding coenzyme a: R23 (≠ K23), S40 (≠ N41), Y41 (= Y42), C44 (≠ I45), R63 (≠ H63), N303 (vs. gap), R307 (= R295)
- binding flavin-adenine dinucleotide: Y33 (≠ F34), E34 (≠ N35), K35 (≠ A36), A43 (≠ R44), C44 (≠ I45), E80 (≠ H80), V81 (= V81), T113 (= T107), G114 (= G108), A115 (≠ S109), L133 (≠ Y127), R134 (= R128), Y159 (≠ L153), G280 (= G274), D281 (≠ E275), P297 (= P289), L298 (= L290), G299 (≠ Y291)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 19, 20, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
32% identity, 31% coverage: 27:276/810 of query aligns to 25:280/409 of 3lxdA
- active site: R44 (= R44), P45 (≠ I45)
- binding flavin-adenine dinucleotide: R36 (≠ A36), E37 (= E37), R44 (= R44), P45 (≠ I45), S48 (= S48), K49 (≠ P49), E81 (≠ H80), V82 (= V81), T109 (= T107), I157 (≠ L154), G278 (= G274), D279 (≠ E275)
Sites not aligning to the query:
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
32% identity, 38% coverage: 5:308/810 of query aligns to 4:314/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G9), G10 (= G11), H11 (≠ M12), A12 (= A13), D34 (≠ A36), E35 (= E37), R42 (= R44), P43 (≠ I45), S46 (= S48), K47 (≠ P49), R78 (≠ H80), M79 (≠ V81), T106 (= T107), R127 (= R128), I153 (≠ L154), D275 (≠ E275), S292 (≠ L286), V293 (= V287)
Sites not aligning to the query:
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
31% identity, 31% coverage: 51:304/810 of query aligns to 52:318/422 of 1q1wA
Sites not aligning to the query:
- active site: 13, 44, 45
- binding flavin-adenine dinucleotide: 10, 12, 13, 14, 35, 36, 44, 45, 49, 329
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 31% coverage: 51:304/810 of query aligns to 53:319/422 of P16640
- V83 (= V81) binding
- R134 (vs. gap) binding
- D284 (≠ E275) binding
- V302 (= V287) binding
Sites not aligning to the query:
- 15 binding
- 37 binding
- 50 binding
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
32% identity, 34% coverage: 1:279/810 of query aligns to 1:279/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G11), V12 (≠ M12), G13 (≠ A13), D35 (≠ A36), E36 (= E37), R43 (= R44), P44 (≠ I45), S47 (= S48), K48 (vs. gap), V80 (= V81), T107 (= T107), G108 (= G108), R128 (= R128), G274 (= G274), D275 (≠ E275)
Sites not aligning to the query:
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
34% identity, 27% coverage: 64:285/810 of query aligns to 77:306/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
32% identity, 34% coverage: 4:279/810 of query aligns to 3:278/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G11), V11 (≠ M12), G12 (≠ A13), D34 (≠ A36), E35 (= E37), R42 (= R44), P43 (≠ I45), K47 (vs. gap), E78 (≠ H80), V79 (= V81), T106 (= T107), G107 (= G108), G273 (= G274), D274 (≠ E275)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ F112), G149 (= G150), L152 (= L153), I153 (≠ L154), E156 (= E157), E172 (≠ H173), A173 (≠ L174), R180 (= R181), V236 (= V237), G237 (= G238), A238 (≠ I239)
Sites not aligning to the query:
Query Sequence
>3608263 FitnessBrowser__Dino:3608263
MKQELVIIGAGMASGRVIEHLLKEDPDAFEITLFNAEPRGNYNRIMLSPVLSGDKSYADI
ITHTDDWYEQNGITCRFGEHVVRIDRETGTVVGQRGALPYDKLLIATGSAPFIIPVEGKD
LPGVITYRDLDDTNAMIEAAASGGKAVVIGGGLLGLEAAAGLKERGMDVTVLHLMGHLME
RQLDESAGFLLRRDLEKRGIKVKCRASTAAILGETRVEGVLLEDNEGLEADLVVMAVGIR
PETRLATDAGLDVARGITVDAELRTSDPDIHAVGECVEFDGQLFGLVAPLYDQARVVADS
LLGRSAAFTPKELSTKLKVTGCDLFSAGDFADGAGREDIVFRDPSRGVYKRLVLEENRLV
GAVFYGDTRDSNWFFGLIQSGEDISEMRDTLIFGPAYQGGAALDPMAAVAALPLDAEICG
CNGVSKGDIVAAIEGGATDLGTVRSLTKASSSCGTCTGLVEQVLGVTLGDDFVIPAAASI
CGCTDLSHEDVRRMIKSRELKSMAAVWQELGWKTSCGCHVCRPALNFYLLADWPLEYRDD
PQSRFINERKHANIQKDGTYSVVPRMWGGMTTPDELRAIADAAEKYNVPTVHVTGGQRID
LLGVRGEDLPAIWADLNAAGMVSGHAYAKGLRTVKTCVGKDHCRFGTQDSTGLGIALEKR
LWGSWTPHKVKLAVSGCPRNCAEATCKDIGVVCVDSGYQIGVAGAAGMDVKETERLADVA
TEQEALDLITAFFQLYRENAKYLDRPYKWVAKVGLDWVKDQVFDADTRQGLIERFELSQS
IYQKDPWAEEARKSGEKYQPLADFKLEAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory